Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LI57

Protein Details
Accession E2LI57    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-112PLMKSLQKRVRKRGKFTLLKHydrophilic
NLS Segment(s)
PositionSequence
100-108KRVRKRGKF
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014906  PRP4-like  
IPR036285  PRP4-like_sf  
Gene Ontology GO:0110165  C:cellular anatomical entity  
KEGG mpr:MPER_06221  -  
Pfam View protein in Pfam  
PF08799  PRP4  
Amino Acid Sequences MAELTYDTLMDDGNYLGSERARLENKVILDELERKKKARSLAVPTDDNRVKARLREIGEPITLFGERAADRRDRLIYVLSQSMQHEETTMKDPLMKSLQKRVRKRGKFTLLKLKRFQHKTERDCPLSPKNLEEWDNPLEGGATLASGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.09
6 0.11
7 0.17
8 0.19
9 0.2
10 0.23
11 0.26
12 0.26
13 0.27
14 0.26
15 0.2
16 0.2
17 0.28
18 0.32
19 0.37
20 0.39
21 0.38
22 0.41
23 0.44
24 0.47
25 0.47
26 0.47
27 0.47
28 0.54
29 0.58
30 0.59
31 0.56
32 0.58
33 0.51
34 0.45
35 0.38
36 0.31
37 0.27
38 0.26
39 0.29
40 0.27
41 0.28
42 0.3
43 0.31
44 0.3
45 0.3
46 0.27
47 0.23
48 0.18
49 0.15
50 0.11
51 0.08
52 0.08
53 0.08
54 0.1
55 0.12
56 0.13
57 0.13
58 0.15
59 0.16
60 0.14
61 0.15
62 0.14
63 0.12
64 0.13
65 0.13
66 0.12
67 0.12
68 0.12
69 0.13
70 0.12
71 0.11
72 0.1
73 0.09
74 0.11
75 0.13
76 0.14
77 0.12
78 0.14
79 0.14
80 0.17
81 0.23
82 0.24
83 0.23
84 0.33
85 0.41
86 0.48
87 0.56
88 0.63
89 0.68
90 0.72
91 0.78
92 0.78
93 0.81
94 0.8
95 0.79
96 0.8
97 0.78
98 0.77
99 0.77
100 0.74
101 0.73
102 0.7
103 0.7
104 0.69
105 0.71
106 0.71
107 0.73
108 0.75
109 0.7
110 0.68
111 0.68
112 0.65
113 0.63
114 0.57
115 0.5
116 0.46
117 0.46
118 0.47
119 0.42
120 0.39
121 0.34
122 0.33
123 0.3
124 0.25
125 0.2
126 0.16
127 0.15
128 0.09
129 0.06