Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J2U4

Protein Details
Accession A0A367J2U4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-119GFGPHKNKKPYVRSEGRKFERARBasic
NLS Segment(s)
PositionSequence
98-129FGPHKNKKPYVRSEGRKFERARGKRASRGFKV
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRVNRPPVTVSRVVRNAKENKTTVVVGTVTDDSRLLDLPKLSIAALHFTKTAKARILKAGGECLTLDQLALRAPTGANTLLIRGAKNSRESVKHFGFGPHKNKKPYVRSEGRKFERARGKRASRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.57
4 0.58
5 0.57
6 0.61
7 0.54
8 0.49
9 0.48
10 0.45
11 0.36
12 0.31
13 0.24
14 0.17
15 0.18
16 0.16
17 0.13
18 0.13
19 0.12
20 0.1
21 0.1
22 0.11
23 0.09
24 0.09
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.12
33 0.12
34 0.12
35 0.13
36 0.12
37 0.16
38 0.17
39 0.19
40 0.19
41 0.21
42 0.22
43 0.26
44 0.28
45 0.26
46 0.25
47 0.26
48 0.21
49 0.19
50 0.17
51 0.12
52 0.11
53 0.09
54 0.08
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.1
69 0.1
70 0.1
71 0.11
72 0.14
73 0.16
74 0.19
75 0.22
76 0.24
77 0.28
78 0.33
79 0.38
80 0.37
81 0.36
82 0.34
83 0.37
84 0.4
85 0.44
86 0.49
87 0.52
88 0.57
89 0.61
90 0.67
91 0.7
92 0.72
93 0.73
94 0.73
95 0.74
96 0.76
97 0.81
98 0.84
99 0.82
100 0.81
101 0.75
102 0.74
103 0.74
104 0.7
105 0.69
106 0.68
107 0.7
108 0.7
109 0.78