Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KCT4

Protein Details
Accession A0A367KCT4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-37KPSSSSGGKKAKKKWSAKKVKDKANNLVHydrophilic
NLS Segment(s)
PositionSequence
11-31PSSSSGGKKAKKKWSAKKVKD
Subcellular Location(s) nucl 19, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MLAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNLVILDQPTHDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.41
4 0.46
5 0.51
6 0.57
7 0.64
8 0.7
9 0.78
10 0.81
11 0.82
12 0.86
13 0.88
14 0.91
15 0.89
16 0.9
17 0.88
18 0.83
19 0.8
20 0.75
21 0.68
22 0.57
23 0.5
24 0.4
25 0.33
26 0.27
27 0.19
28 0.14
29 0.12
30 0.13
31 0.12
32 0.11
33 0.12
34 0.14
35 0.15
36 0.21
37 0.23
38 0.24
39 0.27
40 0.29
41 0.28
42 0.3
43 0.3
44 0.24
45 0.21
46 0.21
47 0.2
48 0.22
49 0.21
50 0.18
51 0.18
52 0.19
53 0.19
54 0.16
55 0.16
56 0.14
57 0.16
58 0.16
59 0.16
60 0.16
61 0.15
62 0.16
63 0.16
64 0.14
65 0.14
66 0.13
67 0.14
68 0.13