Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K694

Protein Details
Accession A0A367K694    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
153-175VTDERKHTKRHPAQKEVWKRMENBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MTSHQPPLIPNIVAVQFLRQASTMLDLPIRTTATAVMYYHRFKTWMDHKEKVIHLDGMTEEEALYQNEEASEHHINSTEVPRKVRDLVNVGYRYYHAKEPTLNIDENYFKMRSSLVTSELLLVRALGFDLEVELPFAYCLNVLRGLGSIRYFVTDERKHTKRHPAQKEVWKRMENGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.18
4 0.18
5 0.19
6 0.15
7 0.14
8 0.14
9 0.17
10 0.16
11 0.13
12 0.14
13 0.13
14 0.14
15 0.16
16 0.16
17 0.13
18 0.12
19 0.12
20 0.12
21 0.14
22 0.13
23 0.14
24 0.18
25 0.2
26 0.22
27 0.21
28 0.21
29 0.19
30 0.28
31 0.34
32 0.39
33 0.43
34 0.46
35 0.48
36 0.54
37 0.55
38 0.5
39 0.43
40 0.35
41 0.28
42 0.25
43 0.22
44 0.17
45 0.16
46 0.12
47 0.09
48 0.08
49 0.09
50 0.08
51 0.08
52 0.06
53 0.05
54 0.05
55 0.06
56 0.06
57 0.1
58 0.11
59 0.11
60 0.11
61 0.12
62 0.12
63 0.14
64 0.2
65 0.21
66 0.22
67 0.23
68 0.24
69 0.25
70 0.28
71 0.28
72 0.24
73 0.22
74 0.23
75 0.28
76 0.28
77 0.26
78 0.23
79 0.22
80 0.23
81 0.21
82 0.21
83 0.15
84 0.16
85 0.17
86 0.19
87 0.24
88 0.24
89 0.22
90 0.19
91 0.2
92 0.2
93 0.2
94 0.21
95 0.15
96 0.12
97 0.12
98 0.12
99 0.11
100 0.14
101 0.15
102 0.14
103 0.15
104 0.16
105 0.17
106 0.18
107 0.17
108 0.12
109 0.11
110 0.08
111 0.07
112 0.07
113 0.04
114 0.04
115 0.03
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.06
127 0.07
128 0.09
129 0.09
130 0.1
131 0.11
132 0.12
133 0.13
134 0.13
135 0.12
136 0.11
137 0.13
138 0.13
139 0.14
140 0.23
141 0.25
142 0.32
143 0.39
144 0.43
145 0.47
146 0.53
147 0.63
148 0.64
149 0.7
150 0.73
151 0.74
152 0.8
153 0.85
154 0.9
155 0.88
156 0.87
157 0.8