Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K7W4

Protein Details
Accession A0A367K7W4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-106DFQVVGKKAKSKKRKPKTDPNAPSKPKRKTGLNKPLIHydrophilic
NLS Segment(s)
PositionSequence
76-99KKAKSKKRKPKTDPNAPSKPKRKT
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKKELKMIVVKGDLNEINLYDIPIESIGFNTLPPDPSFQGFYYPQLQNYFPVYPPMQYTEHFSQYEQIPDFQVVGKKAKSKKRKPKTDPNAPSKPKRKTGLNKPLILSSVLSEFMDAKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.18
4 0.17
5 0.16
6 0.16
7 0.11
8 0.1
9 0.09
10 0.08
11 0.09
12 0.06
13 0.06
14 0.07
15 0.07
16 0.07
17 0.08
18 0.09
19 0.1
20 0.11
21 0.14
22 0.14
23 0.15
24 0.18
25 0.17
26 0.2
27 0.19
28 0.21
29 0.24
30 0.23
31 0.24
32 0.24
33 0.24
34 0.21
35 0.24
36 0.22
37 0.16
38 0.19
39 0.17
40 0.16
41 0.16
42 0.18
43 0.16
44 0.15
45 0.21
46 0.2
47 0.24
48 0.23
49 0.22
50 0.22
51 0.21
52 0.24
53 0.18
54 0.16
55 0.13
56 0.13
57 0.13
58 0.12
59 0.14
60 0.13
61 0.15
62 0.17
63 0.23
64 0.3
65 0.4
66 0.49
67 0.57
68 0.67
69 0.74
70 0.84
71 0.86
72 0.91
73 0.92
74 0.92
75 0.91
76 0.89
77 0.89
78 0.85
79 0.86
80 0.84
81 0.82
82 0.79
83 0.75
84 0.76
85 0.76
86 0.8
87 0.81
88 0.8
89 0.77
90 0.7
91 0.66
92 0.57
93 0.48
94 0.37
95 0.28
96 0.21
97 0.17
98 0.15
99 0.13
100 0.13