Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JFL2

Protein Details
Accession A0A367JFL2    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-29QRDTDARKSKDYKGRDKCRWYHTYFHydrophilic
35-60DLFHLIRRKPPRYSRGKKSRKQVESEBasic
NLS Segment(s)
PositionSequence
41-55RRKPPRYSRGKKSRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences IYGFQRDTDARKSKDYKGRDKCRWYHTYFKPNRSDLFHLIRRKPPRYSRGKKSRKQVESEDEPVKDIERGDSNSSFSFSSATMQPVVVDEGTVEELYQASLIPPAVYSGNNMNHHSDILKDQLAYLQEKYLQMYSSLTDERDKACSFIQTQRTKIKFLESSLNETTHQSTPCIVNLDMFWQDCDTFPSLFTPLEYQQSCTFPSDDNMILSQPQKYEYMISHPSYLQDPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.71
4 0.73
5 0.8
6 0.81
7 0.86
8 0.84
9 0.85
10 0.84
11 0.79
12 0.79
13 0.78
14 0.79
15 0.78
16 0.79
17 0.78
18 0.73
19 0.72
20 0.67
21 0.64
22 0.59
23 0.6
24 0.58
25 0.59
26 0.6
27 0.65
28 0.68
29 0.67
30 0.69
31 0.7
32 0.72
33 0.75
34 0.79
35 0.81
36 0.83
37 0.88
38 0.86
39 0.87
40 0.88
41 0.83
42 0.8
43 0.77
44 0.74
45 0.7
46 0.7
47 0.64
48 0.53
49 0.47
50 0.41
51 0.34
52 0.26
53 0.19
54 0.15
55 0.14
56 0.16
57 0.19
58 0.2
59 0.21
60 0.21
61 0.22
62 0.19
63 0.16
64 0.14
65 0.1
66 0.12
67 0.11
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.11
74 0.08
75 0.07
76 0.05
77 0.05
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.07
95 0.1
96 0.16
97 0.18
98 0.19
99 0.2
100 0.2
101 0.2
102 0.19
103 0.15
104 0.11
105 0.11
106 0.1
107 0.09
108 0.08
109 0.1
110 0.11
111 0.12
112 0.11
113 0.1
114 0.11
115 0.12
116 0.13
117 0.12
118 0.1
119 0.09
120 0.1
121 0.1
122 0.1
123 0.11
124 0.11
125 0.11
126 0.12
127 0.13
128 0.16
129 0.16
130 0.14
131 0.14
132 0.16
133 0.18
134 0.24
135 0.32
136 0.33
137 0.37
138 0.45
139 0.46
140 0.46
141 0.44
142 0.43
143 0.36
144 0.35
145 0.39
146 0.32
147 0.37
148 0.36
149 0.37
150 0.32
151 0.31
152 0.32
153 0.26
154 0.25
155 0.19
156 0.19
157 0.19
158 0.2
159 0.22
160 0.18
161 0.16
162 0.15
163 0.18
164 0.18
165 0.17
166 0.15
167 0.13
168 0.13
169 0.13
170 0.16
171 0.15
172 0.13
173 0.13
174 0.14
175 0.15
176 0.14
177 0.15
178 0.16
179 0.16
180 0.23
181 0.23
182 0.25
183 0.27
184 0.29
185 0.3
186 0.28
187 0.27
188 0.21
189 0.23
190 0.23
191 0.21
192 0.2
193 0.19
194 0.18
195 0.19
196 0.2
197 0.2
198 0.17
199 0.18
200 0.18
201 0.18
202 0.2
203 0.19
204 0.25
205 0.28
206 0.3
207 0.3
208 0.3
209 0.31