Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KKN4

Protein Details
Accession A0A367KKN4   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-152ILKNDHYPSKKRLKRSHQKGKSILDYYKHydrophilic
NLS Segment(s)
PositionSequence
134-143KKRLKRSHQK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036775  DNA_pol_Y-fam_lit_finger_sf  
IPR006642  Rad18_UBZ4  
Gene Ontology GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006281  P:DNA repair  
PROSITE View protein in PROSITE  
PS51908  ZF_UBZ4  
Amino Acid Sequences IKLKSVNYELRVRSKTFPSYLWTAKDIYRIAKELLIKELPINIRLMGIRVSTLKARGTEDESVMKYFTRLSPSTPLITTDDTLPFIKEELPTIECPVCNRQLQLDNLEFNKHVDECLSKMEVKAILKNDHYPSKKRLKRSHQKGKSILDYYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.46
4 0.43
5 0.4
6 0.43
7 0.44
8 0.42
9 0.38
10 0.34
11 0.32
12 0.36
13 0.32
14 0.3
15 0.28
16 0.27
17 0.26
18 0.28
19 0.29
20 0.25
21 0.28
22 0.24
23 0.22
24 0.2
25 0.23
26 0.21
27 0.19
28 0.19
29 0.14
30 0.14
31 0.14
32 0.14
33 0.11
34 0.1
35 0.09
36 0.09
37 0.11
38 0.11
39 0.13
40 0.14
41 0.14
42 0.16
43 0.16
44 0.19
45 0.19
46 0.2
47 0.21
48 0.2
49 0.19
50 0.18
51 0.16
52 0.12
53 0.12
54 0.12
55 0.14
56 0.13
57 0.15
58 0.19
59 0.21
60 0.22
61 0.21
62 0.21
63 0.18
64 0.18
65 0.16
66 0.13
67 0.12
68 0.12
69 0.12
70 0.11
71 0.09
72 0.09
73 0.1
74 0.08
75 0.09
76 0.1
77 0.12
78 0.12
79 0.14
80 0.15
81 0.14
82 0.16
83 0.19
84 0.2
85 0.19
86 0.19
87 0.2
88 0.25
89 0.26
90 0.29
91 0.28
92 0.27
93 0.26
94 0.28
95 0.24
96 0.2
97 0.2
98 0.15
99 0.13
100 0.12
101 0.12
102 0.12
103 0.15
104 0.17
105 0.15
106 0.15
107 0.18
108 0.2
109 0.21
110 0.24
111 0.25
112 0.28
113 0.3
114 0.36
115 0.39
116 0.44
117 0.47
118 0.48
119 0.52
120 0.59
121 0.63
122 0.67
123 0.72
124 0.74
125 0.81
126 0.86
127 0.89
128 0.88
129 0.92
130 0.9
131 0.88
132 0.86