Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IKE4

Protein Details
Accession A0A367IKE4   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
180-203RKPPSKKEPLGQQTSKKRKTTNKGBasic
NLS Segment(s)
PositionSequence
183-189PSKKEPL
192-199QTSKKRKT
Subcellular Location(s) nucl 18.5, mito_nucl 12.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences IKKENNSLTKMIECAQEKGASARVARSMGINVRNAQRWWKHEMKGRPSTFTDEHDSYLIELIDDDSQIIVSDIMERLTEKFEGFSISNSQLNHNLKNDLCLTMKKVTFEAEARNSKENLQQRFDWFMQWKDSDIDFTGNCVFIDEAGFHINMLLEPVLVSPSHTIIGAIHSGSVLFVQLRKPPSKKEPLGQQTSKKRKTTNKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.28
4 0.27
5 0.27
6 0.29
7 0.25
8 0.24
9 0.23
10 0.23
11 0.22
12 0.22
13 0.21
14 0.2
15 0.24
16 0.27
17 0.27
18 0.28
19 0.32
20 0.36
21 0.36
22 0.4
23 0.4
24 0.4
25 0.46
26 0.48
27 0.5
28 0.54
29 0.62
30 0.63
31 0.68
32 0.66
33 0.62
34 0.57
35 0.58
36 0.52
37 0.46
38 0.44
39 0.35
40 0.34
41 0.3
42 0.28
43 0.21
44 0.21
45 0.16
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.03
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.1
70 0.1
71 0.11
72 0.12
73 0.13
74 0.16
75 0.16
76 0.17
77 0.21
78 0.23
79 0.24
80 0.22
81 0.23
82 0.21
83 0.23
84 0.22
85 0.17
86 0.16
87 0.15
88 0.17
89 0.19
90 0.2
91 0.18
92 0.17
93 0.16
94 0.17
95 0.18
96 0.19
97 0.21
98 0.25
99 0.26
100 0.28
101 0.28
102 0.27
103 0.32
104 0.35
105 0.33
106 0.31
107 0.31
108 0.31
109 0.36
110 0.35
111 0.33
112 0.29
113 0.27
114 0.27
115 0.25
116 0.24
117 0.21
118 0.2
119 0.18
120 0.16
121 0.16
122 0.13
123 0.14
124 0.13
125 0.12
126 0.11
127 0.1
128 0.09
129 0.07
130 0.08
131 0.06
132 0.07
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.07
140 0.06
141 0.04
142 0.05
143 0.05
144 0.06
145 0.05
146 0.07
147 0.06
148 0.08
149 0.08
150 0.08
151 0.08
152 0.07
153 0.1
154 0.1
155 0.09
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.06
162 0.06
163 0.07
164 0.1
165 0.16
166 0.22
167 0.3
168 0.34
169 0.41
170 0.5
171 0.59
172 0.62
173 0.65
174 0.7
175 0.72
176 0.78
177 0.78
178 0.78
179 0.79
180 0.84
181 0.85
182 0.8
183 0.8