Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KNT4

Protein Details
Accession A0A367KNT4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-52GKPPGSEKAKKTKRLPKVTSDBasic
NLS Segment(s)
PositionSequence
38-45EKAKKTKR
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012943  Cnn_1N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005815  C:microtubule organizing center  
Pfam View protein in Pfam  
PF07989  Cnn_1N  
Amino Acid Sequences MHSIEPESPIGSQHSRKSSTSHHYEYFSYNLGKPPGSEKAKKTKRLPKVTSDIVPVGHCIQKIAPMKELEKMMTDLKKENFDLKLRLYHSETILSRDYNVYQLSQENSKLRTSLEGVIKRIREYKRELTSVRSAHPGRSIGTQTDPPNKITIARIPDQSELSNHLLQELSLMDTTLYIEKLQNLTLQTTDPHSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.43
4 0.46
5 0.49
6 0.52
7 0.55
8 0.54
9 0.5
10 0.49
11 0.5
12 0.49
13 0.43
14 0.37
15 0.32
16 0.27
17 0.28
18 0.27
19 0.25
20 0.23
21 0.25
22 0.31
23 0.35
24 0.4
25 0.42
26 0.51
27 0.6
28 0.68
29 0.73
30 0.73
31 0.77
32 0.82
33 0.8
34 0.77
35 0.76
36 0.72
37 0.65
38 0.59
39 0.5
40 0.4
41 0.35
42 0.28
43 0.23
44 0.2
45 0.17
46 0.14
47 0.13
48 0.19
49 0.25
50 0.25
51 0.26
52 0.27
53 0.28
54 0.3
55 0.31
56 0.24
57 0.19
58 0.2
59 0.2
60 0.2
61 0.2
62 0.21
63 0.22
64 0.24
65 0.24
66 0.25
67 0.24
68 0.25
69 0.26
70 0.23
71 0.26
72 0.25
73 0.27
74 0.26
75 0.24
76 0.22
77 0.24
78 0.23
79 0.21
80 0.21
81 0.18
82 0.16
83 0.15
84 0.15
85 0.12
86 0.12
87 0.09
88 0.09
89 0.1
90 0.11
91 0.12
92 0.14
93 0.15
94 0.16
95 0.16
96 0.16
97 0.14
98 0.15
99 0.16
100 0.18
101 0.23
102 0.25
103 0.27
104 0.3
105 0.31
106 0.31
107 0.36
108 0.33
109 0.3
110 0.34
111 0.4
112 0.42
113 0.46
114 0.46
115 0.44
116 0.49
117 0.47
118 0.42
119 0.41
120 0.36
121 0.33
122 0.35
123 0.31
124 0.25
125 0.27
126 0.27
127 0.21
128 0.24
129 0.27
130 0.28
131 0.36
132 0.36
133 0.33
134 0.33
135 0.32
136 0.3
137 0.28
138 0.29
139 0.26
140 0.27
141 0.3
142 0.31
143 0.33
144 0.33
145 0.31
146 0.27
147 0.26
148 0.28
149 0.26
150 0.23
151 0.22
152 0.2
153 0.18
154 0.18
155 0.13
156 0.1
157 0.09
158 0.09
159 0.08
160 0.08
161 0.1
162 0.1
163 0.1
164 0.09
165 0.11
166 0.14
167 0.15
168 0.16
169 0.18
170 0.18
171 0.19
172 0.19
173 0.19
174 0.18