Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IR96

Protein Details
Accession A0A367IR96   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-118LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
76-118PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) mito 14, cyto 9.5, cyto_nucl 6.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008233  F:peptidase activity  
GO:0003735  F:structural constituent of ribosome  
GO:0006508  P:proteolysis  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences FLTNRLLQRKQMVVDVIHPGLANVSKDELRTKIGKMYKADKEVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.28
4 0.24
5 0.22
6 0.18
7 0.16
8 0.17
9 0.14
10 0.1
11 0.13
12 0.13
13 0.14
14 0.17
15 0.17
16 0.19
17 0.2
18 0.2
19 0.25
20 0.29
21 0.33
22 0.35
23 0.41
24 0.43
25 0.44
26 0.46
27 0.38
28 0.36
29 0.32
30 0.3
31 0.23
32 0.18
33 0.14
34 0.15
35 0.15
36 0.12
37 0.13
38 0.11
39 0.12
40 0.11
41 0.13
42 0.12
43 0.12
44 0.13
45 0.11
46 0.11
47 0.09
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.1
59 0.13
60 0.15
61 0.22
62 0.29
63 0.34
64 0.44
65 0.48
66 0.5
67 0.48
68 0.52
69 0.47
70 0.43
71 0.41
72 0.33
73 0.27
74 0.22
75 0.23
76 0.2
77 0.21
78 0.26
79 0.32
80 0.39
81 0.5
82 0.6
83 0.69
84 0.77
85 0.85
86 0.89
87 0.92
88 0.94
89 0.94
90 0.94
91 0.93
92 0.93
93 0.92
94 0.92
95 0.92
96 0.92
97 0.93
98 0.94