Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K684

Protein Details
Accession A0A367K684    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRLVVRFTNKDIICQIIYAKLQGDFVLCAAYAHELPRYGIKGGLTNWAAAYATGLLLARRTLTKLGLADKYEGFAEPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.8
4 0.82
5 0.83
6 0.84
7 0.87
8 0.88
9 0.86
10 0.86
11 0.85
12 0.85
13 0.83
14 0.83
15 0.82
16 0.8
17 0.8
18 0.79
19 0.71
20 0.64
21 0.56
22 0.55
23 0.55
24 0.52
25 0.52
26 0.57
27 0.64
28 0.63
29 0.65
30 0.64
31 0.62
32 0.62
33 0.59
34 0.57
35 0.5
36 0.57
37 0.57
38 0.55
39 0.55
40 0.52
41 0.51
42 0.45
43 0.51
44 0.41
45 0.38
46 0.34
47 0.28
48 0.23
49 0.18
50 0.16
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.08
57 0.08
58 0.08
59 0.06
60 0.06
61 0.06
62 0.05
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.08
71 0.11
72 0.12
73 0.12
74 0.13
75 0.13
76 0.14
77 0.15
78 0.21
79 0.19
80 0.17
81 0.17
82 0.16
83 0.15
84 0.12
85 0.12
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.08
94 0.09
95 0.11
96 0.12
97 0.13
98 0.17
99 0.19
100 0.24
101 0.28
102 0.29
103 0.3
104 0.28
105 0.29
106 0.25