Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J6H7

Protein Details
Accession A0A367J6H7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SVHEEKITKSSKKKKKYVSDNNLSYYHydrophilic
54-77DKACNHCKRSHLRCDNVRPCRRCVHydrophilic
NLS Segment(s)
PositionSequence
13-16KKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences SSVHEEKITKSSKKKKKYVSDNNLSYYLAQSDTEDKKMTKSLSNTLLKKGRNVDKACNHCKRSHLRCDNVRPCRRCVATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.84
4 0.88
5 0.89
6 0.89
7 0.89
8 0.84
9 0.78
10 0.69
11 0.59
12 0.48
13 0.37
14 0.27
15 0.17
16 0.12
17 0.1
18 0.14
19 0.16
20 0.17
21 0.18
22 0.17
23 0.18
24 0.2
25 0.21
26 0.19
27 0.19
28 0.22
29 0.29
30 0.36
31 0.35
32 0.39
33 0.43
34 0.4
35 0.41
36 0.44
37 0.44
38 0.45
39 0.47
40 0.5
41 0.53
42 0.62
43 0.68
44 0.69
45 0.65
46 0.6
47 0.64
48 0.66
49 0.66
50 0.68
51 0.68
52 0.68
53 0.74
54 0.83
55 0.85
56 0.86
57 0.87
58 0.8
59 0.76
60 0.76