Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7S3

Protein Details
Accession Q6U7S3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-99GEGKERRKLKFKLKKYKYSLKDKLKLYBasic
NLS Segment(s)
PositionSequence
71-89REGEGKERRKLKFKLKKYK
Subcellular Location(s) mito 12, plas 7, E.R. 5, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Amino Acid Sequences MTIKIFINLYLISIFIIFHNIINKNYTCAAPTITILIKIILFFFQMFGMFSFPAFLLFLRLLAPLPFAKLREGEGKERRKLKFKLKKYKYSLKDKLKLYIVIYKCYIFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.09
4 0.08
5 0.09
6 0.15
7 0.17
8 0.18
9 0.21
10 0.22
11 0.21
12 0.23
13 0.22
14 0.17
15 0.16
16 0.17
17 0.14
18 0.13
19 0.14
20 0.12
21 0.13
22 0.12
23 0.11
24 0.09
25 0.09
26 0.09
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.06
52 0.09
53 0.09
54 0.1
55 0.11
56 0.11
57 0.14
58 0.2
59 0.23
60 0.3
61 0.38
62 0.45
63 0.5
64 0.57
65 0.59
66 0.6
67 0.64
68 0.66
69 0.68
70 0.71
71 0.76
72 0.78
73 0.85
74 0.85
75 0.88
76 0.86
77 0.86
78 0.86
79 0.85
80 0.84
81 0.77
82 0.75
83 0.69
84 0.64
85 0.56
86 0.55
87 0.47
88 0.43
89 0.42