Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KXM4

Protein Details
Accession A0A367KXM4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25SENMAKSKNHTNHNQNKKAHRNGIKHydrophilic
NLS Segment(s)
PositionSequence
18-34KAHRNGIKKTATHKYRS
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences SENMAKSKNHTNHNQNKKAHRNGIKKTATHKYRSSKSLDAKFLRNQRFAKKGTQKALAAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.81
4 0.82
5 0.81
6 0.8
7 0.79
8 0.78
9 0.75
10 0.78
11 0.73
12 0.65
13 0.63
14 0.64
15 0.58
16 0.54
17 0.55
18 0.52
19 0.52
20 0.54
21 0.53
22 0.51
23 0.54
24 0.56
25 0.57
26 0.53
27 0.52
28 0.56
29 0.59
30 0.58
31 0.58
32 0.56
33 0.55
34 0.59
35 0.57
36 0.61
37 0.62
38 0.64
39 0.64
40 0.67
41 0.63