Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IPJ0

Protein Details
Accession A0A367IPJ0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
161-186VLIKAVYPNKSRKKKRLLWLLMKILFHydrophilic
NLS Segment(s)
PositionSequence
172-175RKKK
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences FRGVTMSFNAGYQTFLIRLMIVCTVDLDRSTVGTNRTLRKTYYAEVYVAALENEFRQAERKFEVMSSLIAGVECLLKLDECSNTGVTAFLDILDHSSMKLPYVSEVKSLGRKKKIQRHSALPKDFAKTQFRSTCFASVRKQSSSEVEEEDEQNEEQELCIVLIKAVYPNKSRKKKRLLWLLMKILFVAQTIKRAAHSLLKADSDKKKLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.1
6 0.11
7 0.12
8 0.1
9 0.1
10 0.11
11 0.11
12 0.12
13 0.12
14 0.11
15 0.1
16 0.1
17 0.12
18 0.14
19 0.15
20 0.2
21 0.26
22 0.32
23 0.37
24 0.38
25 0.38
26 0.41
27 0.43
28 0.39
29 0.4
30 0.35
31 0.3
32 0.28
33 0.28
34 0.22
35 0.18
36 0.15
37 0.09
38 0.07
39 0.07
40 0.08
41 0.08
42 0.07
43 0.12
44 0.13
45 0.16
46 0.18
47 0.19
48 0.18
49 0.18
50 0.19
51 0.15
52 0.15
53 0.13
54 0.11
55 0.09
56 0.08
57 0.08
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.07
66 0.07
67 0.07
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.07
74 0.07
75 0.06
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.07
84 0.07
85 0.07
86 0.08
87 0.07
88 0.08
89 0.11
90 0.11
91 0.1
92 0.12
93 0.13
94 0.2
95 0.25
96 0.3
97 0.34
98 0.4
99 0.48
100 0.56
101 0.64
102 0.66
103 0.67
104 0.7
105 0.74
106 0.77
107 0.72
108 0.66
109 0.6
110 0.54
111 0.51
112 0.46
113 0.42
114 0.35
115 0.39
116 0.4
117 0.4
118 0.4
119 0.38
120 0.4
121 0.37
122 0.38
123 0.36
124 0.38
125 0.39
126 0.38
127 0.38
128 0.33
129 0.34
130 0.33
131 0.3
132 0.24
133 0.22
134 0.22
135 0.21
136 0.2
137 0.17
138 0.14
139 0.13
140 0.11
141 0.09
142 0.07
143 0.08
144 0.07
145 0.06
146 0.07
147 0.06
148 0.06
149 0.06
150 0.07
151 0.11
152 0.14
153 0.18
154 0.23
155 0.33
156 0.43
157 0.54
158 0.64
159 0.69
160 0.76
161 0.81
162 0.86
163 0.87
164 0.87
165 0.87
166 0.86
167 0.85
168 0.77
169 0.67
170 0.57
171 0.47
172 0.36
173 0.27
174 0.22
175 0.14
176 0.17
177 0.18
178 0.19
179 0.19
180 0.21
181 0.23
182 0.27
183 0.28
184 0.29
185 0.3
186 0.34
187 0.37
188 0.42
189 0.47
190 0.46