Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J7P2

Protein Details
Accession A0A367J7P2   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
137-167ALSNYARKRRQDNRGKKLKARKQMQEEAHNAHydrophilic
NLS Segment(s)
PositionSequence
143-158RKRRQDNRGKKLKARK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024461  CCDC90-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF07798  CCDC90-like  
Amino Acid Sequences MEQTYSTKTSFYNDTYLIKAGLSELKTDVQMTKRQDVQALKADNNLLAREVDIVAQQLREQVDAIRDEITLELDNKKNETRMDHQEIDIKLQELNNKLTIKLSEVKMGLESVRLETIWKGLAGVAAAGISIGLMAYALSNYARKRRQDNRGKKLKARKQMQEEAHNARFIDMEVVYSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.26
5 0.21
6 0.18
7 0.15
8 0.18
9 0.16
10 0.15
11 0.16
12 0.16
13 0.17
14 0.18
15 0.2
16 0.19
17 0.25
18 0.28
19 0.32
20 0.35
21 0.35
22 0.4
23 0.38
24 0.4
25 0.41
26 0.4
27 0.35
28 0.33
29 0.32
30 0.28
31 0.27
32 0.22
33 0.15
34 0.12
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.11
50 0.12
51 0.13
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.08
58 0.09
59 0.11
60 0.13
61 0.14
62 0.15
63 0.16
64 0.17
65 0.18
66 0.21
67 0.23
68 0.29
69 0.35
70 0.34
71 0.34
72 0.37
73 0.36
74 0.33
75 0.28
76 0.21
77 0.15
78 0.15
79 0.17
80 0.14
81 0.15
82 0.18
83 0.17
84 0.17
85 0.17
86 0.17
87 0.17
88 0.19
89 0.19
90 0.17
91 0.17
92 0.17
93 0.17
94 0.17
95 0.14
96 0.11
97 0.1
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.09
104 0.08
105 0.07
106 0.07
107 0.06
108 0.07
109 0.06
110 0.06
111 0.05
112 0.04
113 0.03
114 0.03
115 0.03
116 0.02
117 0.02
118 0.02
119 0.01
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.04
126 0.08
127 0.11
128 0.2
129 0.26
130 0.31
131 0.41
132 0.5
133 0.6
134 0.68
135 0.76
136 0.79
137 0.84
138 0.87
139 0.86
140 0.88
141 0.86
142 0.86
143 0.84
144 0.83
145 0.82
146 0.84
147 0.83
148 0.8
149 0.78
150 0.77
151 0.7
152 0.63
153 0.54
154 0.45
155 0.37
156 0.29
157 0.24
158 0.15