Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KT65

Protein Details
Accession A0A367KT65    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSKNHTNHNQNKKAHRNGIKKHydrophilic
NLS Segment(s)
PositionSequence
15-28KAHRNGIKKTATHK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKTATHKYRSSKSLDAKFLRNQRFAKKGTEKTLAAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.81
5 0.79
6 0.77
7 0.8
8 0.75
9 0.67
10 0.65
11 0.65
12 0.6
13 0.56
14 0.56
15 0.54
16 0.54
17 0.55
18 0.54
19 0.51
20 0.54
21 0.55
22 0.56
23 0.51
24 0.51
25 0.54
26 0.58
27 0.57
28 0.57
29 0.54
30 0.54
31 0.58
32 0.56
33 0.59
34 0.6
35 0.61
36 0.61
37 0.64
38 0.57
39 0.53