Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IXC8

Protein Details
Accession A0A367IXC8   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
131-150LDISFKAVRCPKRRRLLPFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 7, extr 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001153  Barwin_dom  
IPR036908  RlpA-like_sf  
Gene Ontology GO:0042742  P:defense response to bacterium  
GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF00967  Barwin  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MNLYWIILFTFISQAYAMQGIASMMNATQLLNKRDRGTWYTGEGLRNAACYGRNGMAPFNPSASDMIGAMAMRNLEQCYKCMQITNNRNTRLRIIVKIVDKCEACKIGGAVDLTPRAFKMLSRDGLNIGVLDISFKAVRCPKRRRLLPFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.05
11 0.04
12 0.05
13 0.06
14 0.06
15 0.1
16 0.15
17 0.19
18 0.23
19 0.26
20 0.28
21 0.31
22 0.35
23 0.35
24 0.35
25 0.34
26 0.33
27 0.35
28 0.36
29 0.34
30 0.3
31 0.27
32 0.22
33 0.2
34 0.17
35 0.13
36 0.11
37 0.11
38 0.13
39 0.12
40 0.14
41 0.14
42 0.14
43 0.15
44 0.16
45 0.15
46 0.13
47 0.12
48 0.11
49 0.11
50 0.1
51 0.09
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.05
61 0.05
62 0.08
63 0.08
64 0.09
65 0.12
66 0.14
67 0.14
68 0.16
69 0.19
70 0.26
71 0.34
72 0.43
73 0.47
74 0.49
75 0.51
76 0.5
77 0.49
78 0.46
79 0.4
80 0.34
81 0.3
82 0.32
83 0.35
84 0.37
85 0.36
86 0.34
87 0.31
88 0.3
89 0.3
90 0.26
91 0.2
92 0.18
93 0.17
94 0.14
95 0.16
96 0.15
97 0.12
98 0.13
99 0.15
100 0.14
101 0.14
102 0.13
103 0.12
104 0.11
105 0.12
106 0.17
107 0.22
108 0.26
109 0.29
110 0.3
111 0.3
112 0.31
113 0.3
114 0.23
115 0.15
116 0.11
117 0.08
118 0.08
119 0.07
120 0.08
121 0.09
122 0.09
123 0.16
124 0.23
125 0.33
126 0.42
127 0.52
128 0.6
129 0.7
130 0.79