Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367ISV4

Protein Details
Accession A0A367ISV4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-68TETPKEPESQKIKKKKLDHNLLLSKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012923  Csm3  
IPR040038  TIPIN/Csm3/Swi3  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006974  P:DNA damage response  
GO:0000076  P:DNA replication checkpoint signaling  
GO:0031297  P:replication fork processing  
Pfam View protein in Pfam  
PF07962  Swi3  
Amino Acid Sequences MEDIDSAFDFNFDDINFDIPSTEPTLNTSGQSSPPLEPSTSFTETPKEPESQKIKKKKLDHNLLLSKEGLPRLMSEASFLNFGGRGHEEKNLQKLMRYYQLWANTLFPKLLFKDFAQKVGTPASHKMVRERIGVWQDEYRDRHMIRAEVQDVDKSSSEGEEDEEAYNQMLLDSVFPVSSNERVRSPSPPEAMVEGKEEKEEEERPVEQTTPNRSDALTILAEQRRKRNLAARNTNEIKENTAKKAKIDSNTAKKDQQFIEFSDSDDEQPTFTRKRRMIRQESDEEEEEKEEEEDALEKAKLKFKQFTETDIDLSEIPVIEDIQMEDIGDIQLDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.12
4 0.12
5 0.12
6 0.11
7 0.14
8 0.16
9 0.16
10 0.14
11 0.17
12 0.21
13 0.21
14 0.22
15 0.21
16 0.19
17 0.2
18 0.24
19 0.23
20 0.21
21 0.25
22 0.26
23 0.25
24 0.24
25 0.26
26 0.3
27 0.31
28 0.3
29 0.27
30 0.3
31 0.31
32 0.35
33 0.33
34 0.3
35 0.28
36 0.36
37 0.45
38 0.5
39 0.58
40 0.64
41 0.7
42 0.74
43 0.82
44 0.83
45 0.85
46 0.86
47 0.83
48 0.83
49 0.82
50 0.75
51 0.68
52 0.58
53 0.49
54 0.42
55 0.35
56 0.25
57 0.18
58 0.16
59 0.18
60 0.19
61 0.17
62 0.15
63 0.16
64 0.15
65 0.15
66 0.14
67 0.11
68 0.11
69 0.11
70 0.12
71 0.13
72 0.14
73 0.15
74 0.19
75 0.23
76 0.26
77 0.32
78 0.34
79 0.32
80 0.33
81 0.34
82 0.34
83 0.37
84 0.35
85 0.31
86 0.3
87 0.35
88 0.34
89 0.32
90 0.31
91 0.26
92 0.26
93 0.23
94 0.18
95 0.17
96 0.17
97 0.18
98 0.17
99 0.16
100 0.25
101 0.25
102 0.29
103 0.28
104 0.27
105 0.26
106 0.27
107 0.28
108 0.21
109 0.22
110 0.23
111 0.25
112 0.25
113 0.28
114 0.3
115 0.31
116 0.31
117 0.29
118 0.3
119 0.3
120 0.31
121 0.28
122 0.24
123 0.24
124 0.27
125 0.28
126 0.26
127 0.27
128 0.26
129 0.27
130 0.26
131 0.25
132 0.23
133 0.25
134 0.23
135 0.2
136 0.21
137 0.19
138 0.18
139 0.18
140 0.15
141 0.11
142 0.1
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.06
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.06
165 0.11
166 0.13
167 0.14
168 0.15
169 0.18
170 0.2
171 0.23
172 0.28
173 0.29
174 0.28
175 0.27
176 0.27
177 0.26
178 0.26
179 0.22
180 0.19
181 0.15
182 0.14
183 0.14
184 0.13
185 0.12
186 0.14
187 0.14
188 0.13
189 0.15
190 0.16
191 0.17
192 0.18
193 0.18
194 0.18
195 0.22
196 0.27
197 0.28
198 0.29
199 0.27
200 0.26
201 0.26
202 0.24
203 0.22
204 0.15
205 0.12
206 0.16
207 0.19
208 0.24
209 0.26
210 0.32
211 0.34
212 0.35
213 0.38
214 0.4
215 0.45
216 0.51
217 0.59
218 0.58
219 0.63
220 0.64
221 0.62
222 0.58
223 0.5
224 0.44
225 0.41
226 0.39
227 0.36
228 0.4
229 0.4
230 0.37
231 0.45
232 0.46
233 0.42
234 0.48
235 0.51
236 0.54
237 0.61
238 0.63
239 0.6
240 0.56
241 0.58
242 0.51
243 0.48
244 0.4
245 0.35
246 0.39
247 0.34
248 0.33
249 0.3
250 0.29
251 0.23
252 0.23
253 0.2
254 0.14
255 0.16
256 0.2
257 0.23
258 0.27
259 0.35
260 0.38
261 0.47
262 0.57
263 0.66
264 0.72
265 0.75
266 0.78
267 0.77
268 0.77
269 0.73
270 0.65
271 0.56
272 0.47
273 0.39
274 0.31
275 0.24
276 0.19
277 0.13
278 0.11
279 0.1
280 0.1
281 0.09
282 0.11
283 0.11
284 0.15
285 0.18
286 0.25
287 0.29
288 0.34
289 0.41
290 0.42
291 0.51
292 0.48
293 0.5
294 0.51
295 0.49
296 0.44
297 0.37
298 0.36
299 0.26
300 0.25
301 0.21
302 0.13
303 0.1
304 0.09
305 0.09
306 0.08
307 0.08
308 0.08
309 0.09
310 0.09
311 0.09
312 0.08
313 0.08
314 0.08
315 0.07