Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KCH1

Protein Details
Accession A0A367KCH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
166-185ADHPLAKERLKQNKPNNNKPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 4, cyto 3.5, cyto_nucl 3.5, pero 3, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR006186  Ser/Thr-sp_prot-phosphatase  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00149  Metallophos  
Amino Acid Sequences YGFYDECKRRLSAKMWRAFVDVFNTLPIAALVAGKIFCVHGGLSPSLHSMDDIRNIQRPTDVPDYGLLNDLLWSDPADIDGDWEDNERGVSYVFGKKIINEFQAKFDLDLVCRAHMVVEDGYEFFGNRSLVTIFSAPNYCGEFDNFGAIMSVNEELLCSFELLTPADHPLAKERLKQNKPNNNKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.58
4 0.57
5 0.52
6 0.46
7 0.41
8 0.32
9 0.24
10 0.21
11 0.2
12 0.16
13 0.15
14 0.12
15 0.08
16 0.06
17 0.06
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.07
28 0.11
29 0.11
30 0.11
31 0.12
32 0.13
33 0.13
34 0.13
35 0.11
36 0.1
37 0.11
38 0.16
39 0.18
40 0.19
41 0.24
42 0.24
43 0.24
44 0.25
45 0.23
46 0.25
47 0.27
48 0.26
49 0.21
50 0.22
51 0.23
52 0.21
53 0.21
54 0.15
55 0.09
56 0.09
57 0.09
58 0.08
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.07
79 0.1
80 0.1
81 0.11
82 0.11
83 0.12
84 0.15
85 0.17
86 0.19
87 0.2
88 0.2
89 0.21
90 0.23
91 0.23
92 0.2
93 0.19
94 0.17
95 0.13
96 0.16
97 0.14
98 0.12
99 0.12
100 0.12
101 0.1
102 0.09
103 0.11
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.06
112 0.08
113 0.08
114 0.07
115 0.08
116 0.08
117 0.09
118 0.1
119 0.11
120 0.09
121 0.11
122 0.12
123 0.11
124 0.13
125 0.14
126 0.13
127 0.13
128 0.14
129 0.15
130 0.14
131 0.16
132 0.14
133 0.12
134 0.12
135 0.11
136 0.09
137 0.08
138 0.08
139 0.06
140 0.06
141 0.06
142 0.05
143 0.07
144 0.07
145 0.06
146 0.06
147 0.08
148 0.09
149 0.1
150 0.11
151 0.11
152 0.13
153 0.15
154 0.15
155 0.15
156 0.2
157 0.27
158 0.29
159 0.36
160 0.43
161 0.52
162 0.61
163 0.7
164 0.74
165 0.78