Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IIT6

Protein Details
Accession A0A367IIT6   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24NLHRKIMKSSKKKTVSDKVVHydrophilic
59-90EEEIQKKKDSKEKKKKGKNKDKGGKTKDEPSLBasic
NLS Segment(s)
PositionSequence
62-85IQKKKDSKEKKKKGKNKDKGGKTK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTTENLHRKIMKSSKKKTVSDKVVDPEVFGQTLQASMAQVPPSLRPGMRAWYEKQQRREEEIQKKKDSKEKKKKGKNKDKGGKTKDEPSLEKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.79
4 0.79
5 0.8
6 0.79
7 0.74
8 0.71
9 0.65
10 0.62
11 0.56
12 0.47
13 0.38
14 0.3
15 0.25
16 0.18
17 0.14
18 0.08
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.07
25 0.07
26 0.08
27 0.08
28 0.09
29 0.1
30 0.11
31 0.11
32 0.12
33 0.13
34 0.17
35 0.2
36 0.22
37 0.22
38 0.31
39 0.4
40 0.43
41 0.5
42 0.53
43 0.53
44 0.57
45 0.63
46 0.63
47 0.65
48 0.69
49 0.69
50 0.69
51 0.71
52 0.69
53 0.69
54 0.71
55 0.71
56 0.73
57 0.76
58 0.8
59 0.86
60 0.91
61 0.94
62 0.94
63 0.93
64 0.93
65 0.93
66 0.93
67 0.92
68 0.9
69 0.88
70 0.82
71 0.8
72 0.77
73 0.73
74 0.66