Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KK42

Protein Details
Accession A0A367KK42   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
258-290SILHYRRCHGANKRPRPSKPNMPTKRQRPTTTDHydrophilic
NLS Segment(s)
PositionSequence
271-276RPRPSK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 3.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR006553  Leu-rich_rpt_Cys-con_subtyp  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13516  LRR_6  
Amino Acid Sequences MIPSLYAICLDYLKHHSELISSFENVPFQPIVYTVLEHVFTSTLPLNTNLLGAVSRFGHELRQLDTPWTRLVLSRAATGRSALPSLIAASQLCPQFITCLKLGSCGLRDQDLYRLKEFAHLQVLDVGHNPLITDRGVSYIVTMATLGIHGLQDLYLSHLPGVTDKSLKYVGQLESLVYLDLSKTDVTEQVATTYLTMQGFRKLANLPSARTMTLFPAQLNPKLHGLIRQASVAYAVGNLPSRPALSYEESIGAIDTISILHYRRCHGANKRPRPSKPNMPTKRQRPTTTDYLALIEKELLFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.24
5 0.25
6 0.26
7 0.24
8 0.22
9 0.22
10 0.23
11 0.25
12 0.22
13 0.23
14 0.18
15 0.15
16 0.14
17 0.13
18 0.15
19 0.14
20 0.15
21 0.13
22 0.15
23 0.15
24 0.15
25 0.15
26 0.11
27 0.1
28 0.13
29 0.14
30 0.13
31 0.14
32 0.15
33 0.16
34 0.16
35 0.16
36 0.13
37 0.1
38 0.09
39 0.08
40 0.09
41 0.08
42 0.09
43 0.1
44 0.1
45 0.12
46 0.15
47 0.17
48 0.17
49 0.21
50 0.21
51 0.25
52 0.26
53 0.26
54 0.23
55 0.23
56 0.21
57 0.18
58 0.2
59 0.2
60 0.19
61 0.22
62 0.22
63 0.23
64 0.22
65 0.22
66 0.21
67 0.18
68 0.17
69 0.12
70 0.11
71 0.1
72 0.11
73 0.1
74 0.09
75 0.07
76 0.08
77 0.13
78 0.13
79 0.13
80 0.12
81 0.11
82 0.13
83 0.15
84 0.17
85 0.13
86 0.15
87 0.15
88 0.17
89 0.18
90 0.17
91 0.17
92 0.16
93 0.17
94 0.15
95 0.16
96 0.15
97 0.22
98 0.27
99 0.28
100 0.27
101 0.27
102 0.25
103 0.3
104 0.3
105 0.24
106 0.23
107 0.2
108 0.19
109 0.21
110 0.22
111 0.17
112 0.16
113 0.14
114 0.09
115 0.09
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.1
149 0.08
150 0.09
151 0.09
152 0.11
153 0.12
154 0.12
155 0.13
156 0.15
157 0.15
158 0.15
159 0.16
160 0.14
161 0.13
162 0.13
163 0.12
164 0.07
165 0.06
166 0.04
167 0.04
168 0.05
169 0.04
170 0.05
171 0.05
172 0.07
173 0.08
174 0.09
175 0.09
176 0.09
177 0.1
178 0.1
179 0.09
180 0.09
181 0.09
182 0.09
183 0.1
184 0.1
185 0.13
186 0.13
187 0.13
188 0.15
189 0.15
190 0.17
191 0.23
192 0.25
193 0.22
194 0.26
195 0.28
196 0.25
197 0.25
198 0.23
199 0.19
200 0.2
201 0.2
202 0.16
203 0.21
204 0.23
205 0.28
206 0.29
207 0.28
208 0.26
209 0.27
210 0.27
211 0.25
212 0.26
213 0.25
214 0.24
215 0.23
216 0.22
217 0.2
218 0.2
219 0.16
220 0.12
221 0.08
222 0.07
223 0.07
224 0.09
225 0.09
226 0.09
227 0.1
228 0.1
229 0.1
230 0.12
231 0.15
232 0.17
233 0.19
234 0.2
235 0.2
236 0.2
237 0.19
238 0.17
239 0.13
240 0.09
241 0.07
242 0.05
243 0.04
244 0.05
245 0.06
246 0.07
247 0.11
248 0.14
249 0.17
250 0.22
251 0.25
252 0.33
253 0.41
254 0.51
255 0.59
256 0.68
257 0.76
258 0.8
259 0.85
260 0.85
261 0.84
262 0.84
263 0.83
264 0.84
265 0.82
266 0.84
267 0.86
268 0.89
269 0.9
270 0.88
271 0.84
272 0.8
273 0.78
274 0.77
275 0.71
276 0.64
277 0.55
278 0.49
279 0.44
280 0.37
281 0.31
282 0.23
283 0.18