Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KJH0

Protein Details
Accession A0A367KJH0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-89LTPRKTKAVQKKNYGTKKRKRDNGKASKVDHydrophilic
NLS Segment(s)
PositionSequence
63-84RKTKAVQKKNYGTKKRKRDNGK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 3
Family & Domain DBs
Amino Acid Sequences DEEKRLSGQRKRVQRTSTCTSEETLGDRRRVCRSNLLYPQTEEPERQVLAQFARKGVVELTPRKTKAVQKKNYGTKKRKRDNGKASKVDVNARVSTGSEYFVDFLSSLMDALDQCKMQGRYLVMHHSAIHKVNESQELIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.74
4 0.72
5 0.65
6 0.57
7 0.51
8 0.45
9 0.38
10 0.33
11 0.34
12 0.33
13 0.34
14 0.36
15 0.38
16 0.42
17 0.45
18 0.44
19 0.45
20 0.46
21 0.51
22 0.57
23 0.58
24 0.53
25 0.52
26 0.52
27 0.46
28 0.41
29 0.32
30 0.26
31 0.24
32 0.22
33 0.2
34 0.18
35 0.15
36 0.17
37 0.21
38 0.2
39 0.17
40 0.18
41 0.17
42 0.16
43 0.15
44 0.17
45 0.17
46 0.21
47 0.26
48 0.31
49 0.32
50 0.32
51 0.36
52 0.39
53 0.44
54 0.5
55 0.52
56 0.55
57 0.63
58 0.71
59 0.77
60 0.8
61 0.8
62 0.79
63 0.82
64 0.82
65 0.82
66 0.82
67 0.83
68 0.84
69 0.85
70 0.85
71 0.79
72 0.74
73 0.7
74 0.63
75 0.56
76 0.49
77 0.42
78 0.32
79 0.28
80 0.25
81 0.2
82 0.2
83 0.16
84 0.13
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.08
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.06
97 0.05
98 0.06
99 0.08
100 0.08
101 0.08
102 0.15
103 0.16
104 0.16
105 0.2
106 0.21
107 0.23
108 0.26
109 0.32
110 0.28
111 0.28
112 0.29
113 0.29
114 0.31
115 0.31
116 0.3
117 0.27
118 0.27
119 0.29
120 0.32
121 0.3