Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KTW9

Protein Details
Accession A0A367KTW9   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68GKVGRRTKGCRRRRELYEKDBasic
79-104QSDHSPKEKSKHKRKVIRKTVNGSSMHydrophilic
NLS Segment(s)
PositionSequence
47-62KTGKVGRRTKGCRRRR
85-96KEKSKHKRKVIR
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAPERNKAYRTYVDKLVNTNKEKQENKDVTVAINIGYLSRSTKRQFKTGKVGRRTKGCRRRRELYEKDIKVVRLYSWSQSDHSPKEKSKHKRKVIRKTVNGSSMCINPNCAAVINKKATQSRDAVSARTIALSGLTTLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.59
4 0.59
5 0.56
6 0.6
7 0.58
8 0.61
9 0.63
10 0.62
11 0.63
12 0.59
13 0.57
14 0.54
15 0.47
16 0.39
17 0.36
18 0.3
19 0.2
20 0.16
21 0.13
22 0.08
23 0.08
24 0.08
25 0.09
26 0.12
27 0.17
28 0.2
29 0.28
30 0.3
31 0.39
32 0.44
33 0.47
34 0.56
35 0.59
36 0.65
37 0.66
38 0.72
39 0.68
40 0.72
41 0.73
42 0.73
43 0.75
44 0.75
45 0.76
46 0.75
47 0.78
48 0.78
49 0.8
50 0.76
51 0.75
52 0.76
53 0.66
54 0.62
55 0.56
56 0.48
57 0.38
58 0.32
59 0.22
60 0.16
61 0.17
62 0.16
63 0.17
64 0.18
65 0.18
66 0.21
67 0.26
68 0.26
69 0.3
70 0.32
71 0.33
72 0.4
73 0.48
74 0.55
75 0.61
76 0.68
77 0.73
78 0.78
79 0.85
80 0.89
81 0.91
82 0.91
83 0.88
84 0.84
85 0.81
86 0.78
87 0.69
88 0.59
89 0.5
90 0.43
91 0.38
92 0.31
93 0.27
94 0.19
95 0.19
96 0.18
97 0.17
98 0.15
99 0.16
100 0.23
101 0.26
102 0.28
103 0.32
104 0.36
105 0.38
106 0.39
107 0.4
108 0.34
109 0.38
110 0.37
111 0.34
112 0.31
113 0.3
114 0.26
115 0.22
116 0.2
117 0.12
118 0.11
119 0.1
120 0.09