Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367IRT7

Protein Details
Accession A0A367IRT7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-61LKEPEERKRKRAEKDALPPIABasic
NLS Segment(s)
PositionSequence
46-61ERKRKRAEKDALPPIA
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MFNQQQKPAFKFVIRSKIDDQTIEEKQEPASIHKPAVNEILKEPEERKRKRAEKDALPPIAAKKIHSQLERWNRKQEELKQERETEEEIERGRNNYIDIVTLVCVLCQRKFKSKPDLEKHQAVSELHKKNLNDTSAVNKAKLKIGFMKSEQDLQMKIPEPITEYRNRAAERRQAYGQPEKPILSPPPPPPRQLSTPHAIEALPKASMNIPISENNKGARMLLQMGWKKGEGLGKHGTGILDPIKAESYAQSAGIGSTDNRRNLPRKKLLGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.53
4 0.57
5 0.56
6 0.49
7 0.46
8 0.43
9 0.44
10 0.42
11 0.39
12 0.32
13 0.3
14 0.32
15 0.29
16 0.28
17 0.29
18 0.27
19 0.28
20 0.3
21 0.3
22 0.29
23 0.36
24 0.32
25 0.29
26 0.28
27 0.33
28 0.31
29 0.33
30 0.34
31 0.35
32 0.42
33 0.45
34 0.5
35 0.54
36 0.61
37 0.68
38 0.75
39 0.75
40 0.75
41 0.8
42 0.83
43 0.74
44 0.66
45 0.59
46 0.51
47 0.48
48 0.39
49 0.3
50 0.28
51 0.32
52 0.38
53 0.38
54 0.38
55 0.42
56 0.52
57 0.61
58 0.58
59 0.61
60 0.56
61 0.61
62 0.66
63 0.65
64 0.65
65 0.62
66 0.65
67 0.6
68 0.61
69 0.56
70 0.5
71 0.43
72 0.35
73 0.29
74 0.25
75 0.2
76 0.21
77 0.21
78 0.2
79 0.19
80 0.17
81 0.16
82 0.14
83 0.13
84 0.11
85 0.1
86 0.09
87 0.09
88 0.09
89 0.08
90 0.07
91 0.09
92 0.1
93 0.12
94 0.18
95 0.21
96 0.3
97 0.36
98 0.42
99 0.51
100 0.57
101 0.65
102 0.66
103 0.73
104 0.69
105 0.68
106 0.64
107 0.54
108 0.49
109 0.39
110 0.37
111 0.37
112 0.34
113 0.3
114 0.32
115 0.31
116 0.32
117 0.35
118 0.3
119 0.22
120 0.2
121 0.23
122 0.27
123 0.27
124 0.25
125 0.22
126 0.22
127 0.25
128 0.24
129 0.21
130 0.21
131 0.23
132 0.26
133 0.26
134 0.28
135 0.25
136 0.28
137 0.27
138 0.22
139 0.19
140 0.17
141 0.2
142 0.17
143 0.17
144 0.14
145 0.13
146 0.14
147 0.16
148 0.19
149 0.2
150 0.22
151 0.24
152 0.28
153 0.29
154 0.29
155 0.32
156 0.36
157 0.34
158 0.35
159 0.35
160 0.34
161 0.38
162 0.45
163 0.44
164 0.4
165 0.39
166 0.36
167 0.34
168 0.35
169 0.33
170 0.27
171 0.29
172 0.33
173 0.42
174 0.43
175 0.45
176 0.46
177 0.48
178 0.49
179 0.5
180 0.47
181 0.43
182 0.42
183 0.41
184 0.37
185 0.31
186 0.28
187 0.24
188 0.2
189 0.14
190 0.12
191 0.12
192 0.12
193 0.17
194 0.17
195 0.16
196 0.17
197 0.21
198 0.25
199 0.27
200 0.28
201 0.25
202 0.25
203 0.23
204 0.22
205 0.18
206 0.17
207 0.17
208 0.18
209 0.25
210 0.27
211 0.29
212 0.3
213 0.29
214 0.27
215 0.27
216 0.3
217 0.22
218 0.24
219 0.28
220 0.27
221 0.27
222 0.28
223 0.25
224 0.2
225 0.23
226 0.18
227 0.14
228 0.13
229 0.14
230 0.14
231 0.14
232 0.14
233 0.12
234 0.14
235 0.13
236 0.14
237 0.13
238 0.12
239 0.12
240 0.11
241 0.11
242 0.09
243 0.17
244 0.23
245 0.26
246 0.29
247 0.37
248 0.46
249 0.54
250 0.63
251 0.65
252 0.67