Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JCC1

Protein Details
Accession A0A367JCC1   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-56LLGGGKKRKKKTYTTPKKIKHKRTKVKLAILKYBasic
NLS Segment(s)
PositionSequence
27-50GGKKRKKKTYTTPKKIKHKRTKVK
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences PLVDGELALYGIANNNTLNLNAELLGGGKKRKKKTYTTPKKIKHKRTKVKLAILKYYKVDESGKVTRLRRECPNATCGAGVFMAKHKDRQYCGKCHLTYVFQKDQQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.1
5 0.12
6 0.1
7 0.11
8 0.1
9 0.1
10 0.09
11 0.09
12 0.11
13 0.1
14 0.16
15 0.21
16 0.28
17 0.36
18 0.45
19 0.5
20 0.57
21 0.66
22 0.72
23 0.78
24 0.82
25 0.85
26 0.85
27 0.91
28 0.92
29 0.92
30 0.91
31 0.91
32 0.9
33 0.9
34 0.91
35 0.87
36 0.86
37 0.81
38 0.73
39 0.7
40 0.62
41 0.54
42 0.44
43 0.38
44 0.28
45 0.25
46 0.22
47 0.15
48 0.19
49 0.21
50 0.24
51 0.29
52 0.3
53 0.35
54 0.38
55 0.41
56 0.43
57 0.47
58 0.49
59 0.46
60 0.48
61 0.44
62 0.41
63 0.36
64 0.29
65 0.22
66 0.17
67 0.14
68 0.1
69 0.13
70 0.18
71 0.19
72 0.24
73 0.28
74 0.34
75 0.38
76 0.48
77 0.51
78 0.53
79 0.59
80 0.63
81 0.58
82 0.57
83 0.57
84 0.54
85 0.55
86 0.55
87 0.56