Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IX22

Protein Details
Accession A0A367IX22    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-50SYYHDTVKKESKKRHRKSRMFILNRLHydrophilic
NLS Segment(s)
PositionSequence
32-50KKESKKRHRKSRMFILNRL
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MYTIKQDKPNLTIRLKLNTIHKKNSYYHDTVKKESKKRHRKSRMFILNRLRKQGKSSLTIDKQAKDTPLSTGRSFYWTSERIETTKFILRTVMTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.48
4 0.49
5 0.52
6 0.55
7 0.56
8 0.57
9 0.55
10 0.58
11 0.61
12 0.58
13 0.52
14 0.54
15 0.56
16 0.56
17 0.56
18 0.61
19 0.62
20 0.63
21 0.68
22 0.7
23 0.72
24 0.78
25 0.85
26 0.87
27 0.87
28 0.87
29 0.88
30 0.88
31 0.82
32 0.79
33 0.78
34 0.77
35 0.69
36 0.68
37 0.6
38 0.49
39 0.48
40 0.47
41 0.4
42 0.36
43 0.38
44 0.4
45 0.4
46 0.46
47 0.45
48 0.4
49 0.39
50 0.36
51 0.34
52 0.27
53 0.25
54 0.23
55 0.26
56 0.29
57 0.27
58 0.27
59 0.26
60 0.28
61 0.29
62 0.26
63 0.27
64 0.25
65 0.28
66 0.3
67 0.32
68 0.3
69 0.31
70 0.31
71 0.28
72 0.33
73 0.3
74 0.26
75 0.26