Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369HFX1

Protein Details
Accession A0A369HFX1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-171VKESKEERRARREARRLKKTEERHQKKLARKMRKVGABasic
176-201LDAVGKAPKERDKRRKTKDNKKATAABasic
NLS Segment(s)
PositionSequence
138-199SKEERRARREARRLKKTEERHQKKLARKMRKVGAGELVLDAVGKAPKERDKRRKTKDNKKAT
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MNAHALLSAQGWRGKGHSLHKTDDSIGLAKPLLLPRKDCKTGIGSTQHFTSDQWWMNAFDEQLKGLDTSEEGRVTQTVTTGKLNSIDKGSLGKYYLYTSFVRGGLLEGTVPSLKAELSSPEAHDKPIDAPSSLPVKESKEERRARREARRLKKTEERHQKKLARKMRKVGAGELVLDAVGKAPKERDKRRKTKDNKKATAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.33
4 0.39
5 0.41
6 0.46
7 0.48
8 0.49
9 0.46
10 0.43
11 0.37
12 0.29
13 0.25
14 0.21
15 0.18
16 0.16
17 0.17
18 0.2
19 0.24
20 0.25
21 0.29
22 0.34
23 0.43
24 0.46
25 0.44
26 0.42
27 0.4
28 0.4
29 0.42
30 0.44
31 0.38
32 0.36
33 0.36
34 0.34
35 0.29
36 0.27
37 0.23
38 0.21
39 0.21
40 0.2
41 0.2
42 0.21
43 0.21
44 0.22
45 0.2
46 0.15
47 0.14
48 0.13
49 0.12
50 0.11
51 0.1
52 0.09
53 0.08
54 0.07
55 0.08
56 0.1
57 0.1
58 0.09
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.09
65 0.1
66 0.12
67 0.12
68 0.12
69 0.15
70 0.16
71 0.15
72 0.15
73 0.13
74 0.12
75 0.14
76 0.14
77 0.11
78 0.11
79 0.1
80 0.09
81 0.11
82 0.11
83 0.12
84 0.12
85 0.13
86 0.14
87 0.14
88 0.13
89 0.11
90 0.11
91 0.08
92 0.08
93 0.06
94 0.04
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.1
105 0.11
106 0.12
107 0.17
108 0.18
109 0.18
110 0.17
111 0.17
112 0.15
113 0.18
114 0.17
115 0.13
116 0.13
117 0.15
118 0.2
119 0.19
120 0.18
121 0.16
122 0.19
123 0.22
124 0.28
125 0.32
126 0.38
127 0.46
128 0.53
129 0.6
130 0.65
131 0.71
132 0.75
133 0.78
134 0.78
135 0.81
136 0.84
137 0.8
138 0.8
139 0.81
140 0.8
141 0.8
142 0.81
143 0.79
144 0.76
145 0.81
146 0.81
147 0.81
148 0.82
149 0.81
150 0.8
151 0.8
152 0.8
153 0.78
154 0.79
155 0.72
156 0.65
157 0.62
158 0.52
159 0.45
160 0.36
161 0.28
162 0.2
163 0.17
164 0.13
165 0.08
166 0.09
167 0.08
168 0.1
169 0.15
170 0.24
171 0.35
172 0.46
173 0.55
174 0.65
175 0.76
176 0.85
177 0.9
178 0.93
179 0.94
180 0.94
181 0.94