Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369HAH5

Protein Details
Accession A0A369HAH5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-105LLDFFDKKKKEKKGASPQGKEGPBasic
NLS Segment(s)
PositionSequence
89-102KKKKEKKGASPQGK
Subcellular Location(s) extr 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MKISAVFLTTLAALSQATPLPAPQTDVAVSNLHARQLPNPLALLPLIAEIPQGAFYVLSSPINLAKTFGSSVVDKGAGGLNKLLDFFDKKKKEKKGASPQGKEGPGPEMAAGPGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.07
4 0.08
5 0.08
6 0.08
7 0.1
8 0.11
9 0.13
10 0.12
11 0.13
12 0.13
13 0.15
14 0.16
15 0.14
16 0.15
17 0.17
18 0.17
19 0.17
20 0.18
21 0.17
22 0.17
23 0.23
24 0.23
25 0.19
26 0.19
27 0.18
28 0.17
29 0.16
30 0.13
31 0.07
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.05
47 0.06
48 0.07
49 0.09
50 0.09
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.08
62 0.09
63 0.11
64 0.1
65 0.1
66 0.1
67 0.09
68 0.1
69 0.1
70 0.1
71 0.09
72 0.13
73 0.17
74 0.26
75 0.34
76 0.4
77 0.49
78 0.58
79 0.66
80 0.71
81 0.78
82 0.79
83 0.83
84 0.87
85 0.84
86 0.82
87 0.8
88 0.72
89 0.62
90 0.52
91 0.44
92 0.34
93 0.3
94 0.23
95 0.15