Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369H4M9

Protein Details
Accession A0A369H4M9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-23NGAKAQQKRERNQKDGKAAKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, nucl 10, cyto_mito 8.999, cyto_nucl 8.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAQQKRERNQKDGKAAKSQLKVNEKAKSIQCQICKATFLQTMKVPALLEHASNKHSKGLADCFPGVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.81
4 0.8
5 0.75
6 0.73
7 0.69
8 0.67
9 0.62
10 0.59
11 0.56
12 0.55
13 0.57
14 0.54
15 0.53
16 0.48
17 0.48
18 0.47
19 0.44
20 0.43
21 0.41
22 0.38
23 0.36
24 0.36
25 0.32
26 0.3
27 0.25
28 0.23
29 0.24
30 0.22
31 0.21
32 0.21
33 0.23
34 0.22
35 0.23
36 0.19
37 0.14
38 0.17
39 0.15
40 0.15
41 0.16
42 0.18
43 0.19
44 0.21
45 0.22
46 0.22
47 0.22
48 0.22
49 0.23
50 0.28
51 0.3
52 0.33
53 0.33