Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GVT9

Protein Details
Accession A0A369GVT9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-149KAIEESRRRKIRHQRSREKRRFNDYLRRQTTBasic
NLS Segment(s)
PositionSequence
124-139SRRRKIRHQRSREKRR
Subcellular Location(s) cyto_nucl 14.5, cyto 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSDEDKELLARIGQIAGQINRHKSQQATVAPGTHPAPQHRNAYRHSSAPYPRAGYRGGRPTPAHRHRTLRLNDPKTKQESGAADGEVSSGQGKWVSRTDRHRQLINADIYQKDAQNRFKAIEESRRRKIRHQRSREKRRFNDYLRRQTTAAASVSESVNEIVIEGMRFRVADGGKKLLKVTDDLKSAPSTPKTVDVAGVIFHRTKTGNLVASRVVRDHRYVLLSVDSLRLTACSRSGMVKKTDQMCRIFSTTGSCPKGPRCRYIHDATKVAICREFLKEGKCGEGDSCDLSHEVSAERVPNCVHFAKGHCAKPDCPYTHSKAAPGAAVCEAFGFLGYCEKGSECTDRHVSECPDFSNTGSCKTKGCKLLHREKASVLRAHGRAREEASDDDVSSDAESACSNDVDSDEVASLVHAETDESDADEDGQDFIRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.2
4 0.26
5 0.31
6 0.36
7 0.38
8 0.41
9 0.41
10 0.37
11 0.4
12 0.42
13 0.41
14 0.42
15 0.42
16 0.43
17 0.39
18 0.41
19 0.38
20 0.34
21 0.33
22 0.33
23 0.37
24 0.39
25 0.49
26 0.52
27 0.56
28 0.56
29 0.62
30 0.58
31 0.55
32 0.53
33 0.51
34 0.51
35 0.5
36 0.51
37 0.46
38 0.44
39 0.43
40 0.43
41 0.4
42 0.41
43 0.46
44 0.44
45 0.46
46 0.47
47 0.53
48 0.61
49 0.66
50 0.65
51 0.62
52 0.67
53 0.66
54 0.73
55 0.7
56 0.69
57 0.71
58 0.72
59 0.74
60 0.72
61 0.74
62 0.7
63 0.67
64 0.58
65 0.53
66 0.47
67 0.42
68 0.39
69 0.31
70 0.25
71 0.22
72 0.22
73 0.15
74 0.13
75 0.09
76 0.06
77 0.06
78 0.09
79 0.09
80 0.12
81 0.18
82 0.23
83 0.3
84 0.38
85 0.48
86 0.55
87 0.59
88 0.6
89 0.56
90 0.55
91 0.57
92 0.52
93 0.46
94 0.39
95 0.35
96 0.35
97 0.34
98 0.32
99 0.29
100 0.31
101 0.34
102 0.36
103 0.37
104 0.35
105 0.35
106 0.38
107 0.37
108 0.42
109 0.46
110 0.49
111 0.57
112 0.63
113 0.64
114 0.69
115 0.75
116 0.76
117 0.76
118 0.79
119 0.82
120 0.85
121 0.94
122 0.94
123 0.94
124 0.9
125 0.88
126 0.86
127 0.83
128 0.83
129 0.81
130 0.82
131 0.75
132 0.7
133 0.62
134 0.54
135 0.48
136 0.41
137 0.31
138 0.21
139 0.18
140 0.16
141 0.16
142 0.14
143 0.12
144 0.08
145 0.07
146 0.06
147 0.06
148 0.04
149 0.05
150 0.05
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.09
157 0.09
158 0.14
159 0.16
160 0.21
161 0.22
162 0.23
163 0.23
164 0.2
165 0.2
166 0.18
167 0.19
168 0.18
169 0.19
170 0.19
171 0.2
172 0.2
173 0.21
174 0.22
175 0.2
176 0.17
177 0.16
178 0.19
179 0.19
180 0.18
181 0.17
182 0.14
183 0.13
184 0.12
185 0.11
186 0.09
187 0.09
188 0.08
189 0.09
190 0.09
191 0.09
192 0.12
193 0.14
194 0.17
195 0.17
196 0.18
197 0.19
198 0.2
199 0.21
200 0.19
201 0.18
202 0.15
203 0.15
204 0.16
205 0.15
206 0.14
207 0.14
208 0.14
209 0.13
210 0.12
211 0.11
212 0.11
213 0.09
214 0.08
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.07
221 0.08
222 0.12
223 0.15
224 0.18
225 0.21
226 0.23
227 0.28
228 0.33
229 0.38
230 0.38
231 0.38
232 0.36
233 0.36
234 0.35
235 0.3
236 0.24
237 0.23
238 0.22
239 0.27
240 0.28
241 0.26
242 0.26
243 0.33
244 0.43
245 0.42
246 0.46
247 0.43
248 0.46
249 0.52
250 0.56
251 0.58
252 0.53
253 0.52
254 0.44
255 0.45
256 0.4
257 0.35
258 0.29
259 0.21
260 0.19
261 0.19
262 0.22
263 0.2
264 0.21
265 0.24
266 0.23
267 0.25
268 0.23
269 0.21
270 0.17
271 0.17
272 0.15
273 0.14
274 0.13
275 0.11
276 0.11
277 0.11
278 0.1
279 0.09
280 0.08
281 0.07
282 0.08
283 0.12
284 0.12
285 0.13
286 0.13
287 0.14
288 0.18
289 0.18
290 0.17
291 0.16
292 0.19
293 0.27
294 0.34
295 0.37
296 0.39
297 0.41
298 0.42
299 0.45
300 0.5
301 0.44
302 0.41
303 0.43
304 0.44
305 0.49
306 0.48
307 0.44
308 0.38
309 0.37
310 0.35
311 0.29
312 0.24
313 0.17
314 0.16
315 0.14
316 0.11
317 0.1
318 0.07
319 0.07
320 0.06
321 0.05
322 0.08
323 0.09
324 0.09
325 0.09
326 0.1
327 0.12
328 0.15
329 0.2
330 0.18
331 0.24
332 0.29
333 0.29
334 0.31
335 0.35
336 0.35
337 0.34
338 0.35
339 0.3
340 0.29
341 0.28
342 0.27
343 0.29
344 0.26
345 0.3
346 0.32
347 0.31
348 0.32
349 0.36
350 0.43
351 0.43
352 0.48
353 0.5
354 0.56
355 0.66
356 0.72
357 0.74
358 0.69
359 0.66
360 0.69
361 0.66
362 0.6
363 0.53
364 0.51
365 0.5
366 0.53
367 0.51
368 0.46
369 0.43
370 0.42
371 0.41
372 0.36
373 0.33
374 0.33
375 0.3
376 0.27
377 0.24
378 0.21
379 0.18
380 0.15
381 0.15
382 0.09
383 0.08
384 0.08
385 0.09
386 0.1
387 0.1
388 0.1
389 0.09
390 0.1
391 0.12
392 0.12
393 0.11
394 0.1
395 0.1
396 0.1
397 0.09
398 0.09
399 0.07
400 0.07
401 0.06
402 0.06
403 0.07
404 0.09
405 0.1
406 0.1
407 0.11
408 0.1
409 0.11
410 0.12
411 0.11
412 0.1