Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369H8N2

Protein Details
Accession A0A369H8N2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
63-85AAARIKKNKKSNNVKFKVRCQRHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKVSQFTLVLPRPALHRNLPPQGRFLYVHLHLLPLKTLFRAVPEPRLRFFFSLNAAARIKKNKKSNNVKFKVRCQRHLYTLVLKDTDKAEKLKQSLPPNLHITDLSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.32
3 0.33
4 0.29
5 0.29
6 0.29
7 0.3
8 0.33
9 0.34
10 0.28
11 0.33
12 0.37
13 0.46
14 0.51
15 0.48
16 0.47
17 0.45
18 0.44
19 0.37
20 0.32
21 0.28
22 0.24
23 0.26
24 0.22
25 0.23
26 0.2
27 0.19
28 0.18
29 0.14
30 0.13
31 0.1
32 0.11
33 0.09
34 0.11
35 0.17
36 0.17
37 0.25
38 0.31
39 0.33
40 0.34
41 0.37
42 0.36
43 0.31
44 0.31
45 0.24
46 0.19
47 0.23
48 0.22
49 0.22
50 0.21
51 0.22
52 0.23
53 0.31
54 0.34
55 0.36
56 0.45
57 0.49
58 0.59
59 0.69
60 0.77
61 0.79
62 0.8
63 0.82
64 0.79
65 0.82
66 0.82
67 0.77
68 0.75
69 0.71
70 0.69
71 0.65
72 0.65
73 0.58
74 0.55
75 0.53
76 0.48
77 0.42
78 0.37
79 0.33
80 0.3
81 0.31
82 0.26
83 0.25
84 0.27
85 0.31
86 0.35
87 0.39
88 0.44
89 0.47
90 0.53
91 0.53
92 0.55
93 0.53
94 0.51
95 0.47
96 0.41
97 0.37