Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369H547

Protein Details
Accession A0A369H547    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-42AGALRLKGAKVQKRKKKNKNKNKEVADKLASHydrophilic
NLS Segment(s)
PositionSequence
16-34RLKGAKVQKRKKKNKNKNK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDEYATVAGAGALRLKGAKVQKRKKKNKNKNKEVADKLASVPQPDADADSAKPDTAANDEAVDDDQDETLVQKTESERRYEEAKKKRMLQMARASGARPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.13
6 0.22
7 0.3
8 0.4
9 0.51
10 0.6
11 0.72
12 0.83
13 0.88
14 0.91
15 0.94
16 0.94
17 0.95
18 0.96
19 0.95
20 0.93
21 0.92
22 0.87
23 0.82
24 0.74
25 0.64
26 0.54
27 0.49
28 0.4
29 0.31
30 0.25
31 0.18
32 0.16
33 0.14
34 0.14
35 0.09
36 0.1
37 0.09
38 0.11
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.1
45 0.11
46 0.08
47 0.08
48 0.08
49 0.08
50 0.09
51 0.08
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.08
63 0.15
64 0.17
65 0.2
66 0.2
67 0.22
68 0.29
69 0.36
70 0.43
71 0.46
72 0.52
73 0.55
74 0.59
75 0.63
76 0.64
77 0.6
78 0.59
79 0.59
80 0.57
81 0.54
82 0.49
83 0.43
84 0.37
85 0.35
86 0.27
87 0.18
88 0.14
89 0.16
90 0.2
91 0.26
92 0.3
93 0.37
94 0.4
95 0.41
96 0.43
97 0.45
98 0.48
99 0.45
100 0.42
101 0.41
102 0.38
103 0.37
104 0.35
105 0.28
106 0.21
107 0.19
108 0.2
109 0.19
110 0.21
111 0.27
112 0.33
113 0.34