FuNGI

A0A369GZK7

Protein Details

Accession

A0A369GZK7

Localization Confidence

Medium

Confidence Score

12.8

NoLS Segment(s)

Position	Sequence	Protein Nature
67-92	APVPTQWSPKPPKPWKWQPPIDPNTV	Hydrophilic
431-471	LRRVHVPSVKPPRKPRGWEAKRQSPRYRHLWKYTRRIRGVS	Hydrophilic

NLS Segment(s)

Position	Sequence
439-476	VKPPRKPRGWEAKRQSPRYRHLWKYTRRIRGVSNGRGW
478-480	KRR

Subcellular Location(s)

mito 21.5, cyto_mito 12.5, nucl 3

Family & Domain DBs

InterPro	View protein in InterPro IPR008914 PEBP IPR036610 PEBP-like_sf IPR035810 PEBP_euk
Pfam	View protein in Pfam PF01161 PBP
CDD	cd00866 PEBP_euk

Amino Acid Sequences

MSRFRQVARPLTGLQLRRRRLVISLRRLESGVAGPPPPPPSPPPPPPPPPEVPPSSGALPPQSPSSAPVPTQWSPKPPKPWKWQPPIDPNTVLPQFEAQLQKTGLMPIGSRRRRIALRSCTTDIPFEQLPYQAFQEALKILAADRVDKLERLRLQLAKITRLEKKDAADVNGGQRLKDQRLAGMREEAERLKILADINDPLVKKRFEDGLGDMNKPIYRFLLRKKWLAYDHKLITQRIEQFHIVPDLLPKLEPSADVKLVFRGVKIPPGSIVPSRVSEKPPLLRIQLFDKGERLFTVVVVDADVPDFEKDGFTKRCHYLAANIVIGPCNSSLPLAKVKAENVALPWLPPVSQKGSPYHRLAIFVLEQQSGEVVDIAKLRELYSARDGFSVKSFRDKFPVLPVGFNMFRSLWDDDTADVMAEHGIPGADVELRRVHVPSVKPPRKPRGWEAKRQSPRYRHLWKYTRRIRGVSNGRGWCKRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.57
2	0.58
3	0.57
4	0.58
5	0.58
6	0.52
7	0.53
8	0.57
9	0.57
10	0.58
11	0.63
12	0.6
13	0.6
14	0.59
15	0.52
16	0.44
17	0.36
18	0.3
19	0.23
20	0.21
21	0.2
22	0.24
23	0.28
24	0.26
25	0.27
26	0.28
27	0.34
28	0.42
29	0.5
30	0.55
31	0.59
32	0.66
33	0.68
34	0.7
35	0.67
36	0.64
37	0.63
38	0.59
39	0.54
40	0.48
41	0.46
42	0.41
43	0.36
44	0.33
45	0.29
46	0.26
47	0.23
48	0.23
49	0.21
50	0.19
51	0.21
52	0.23
53	0.22
54	0.21
55	0.24
56	0.29
57	0.3
58	0.37
59	0.38
60	0.43
61	0.49
62	0.56
63	0.63
64	0.66
65	0.73
66	0.76
67	0.84
68	0.85
69	0.87
70	0.89
71	0.88
72	0.89
73	0.85
74	0.8
75	0.71
76	0.62
77	0.59
78	0.52
79	0.42
80	0.32
81	0.27
82	0.21
83	0.24
84	0.27
85	0.2
86	0.22
87	0.23
88	0.23
89	0.22
90	0.22
91	0.19
92	0.15
93	0.15
94	0.19
95	0.29
96	0.33
97	0.36
98	0.37
99	0.41
100	0.45
101	0.51
102	0.53
103	0.53
104	0.56
105	0.6
106	0.61
107	0.58
108	0.55
109	0.51
110	0.41
111	0.35
112	0.28
113	0.22
114	0.2
115	0.19
116	0.19
117	0.17
118	0.18
119	0.14
120	0.14
121	0.12
122	0.13
123	0.11
124	0.11
125	0.09
126	0.08
127	0.08
128	0.1
129	0.1
130	0.09
131	0.1
132	0.13
133	0.13
134	0.15
135	0.16
136	0.21
137	0.23
138	0.26
139	0.3
140	0.29
141	0.3
142	0.33
143	0.34
144	0.32
145	0.33
146	0.33
147	0.34
148	0.34
149	0.37
150	0.35
151	0.34
152	0.36
153	0.35
154	0.33
155	0.3
156	0.29
157	0.28
158	0.3
159	0.28
160	0.22
161	0.23
162	0.25
163	0.24
164	0.27
165	0.24
166	0.23
167	0.29
168	0.32
169	0.29
170	0.29
171	0.28
172	0.24
173	0.26
174	0.22
175	0.18
176	0.15
177	0.14
178	0.1
179	0.11
180	0.1
181	0.09
182	0.1
183	0.1
184	0.11
185	0.14
186	0.14
187	0.14
188	0.17
189	0.16
190	0.16
191	0.17
192	0.18
193	0.16
194	0.18
195	0.19
196	0.23
197	0.25
198	0.25
199	0.23
200	0.22
201	0.22
202	0.19
203	0.17
204	0.11
205	0.12
206	0.15
207	0.22
208	0.31
209	0.33
210	0.37
211	0.38
212	0.42
213	0.45
214	0.49
215	0.47
216	0.45
217	0.43
218	0.45
219	0.46
220	0.41
221	0.37
222	0.34
223	0.33
224	0.27
225	0.28
226	0.23
227	0.2
228	0.21
229	0.2
230	0.15
231	0.11
232	0.11
233	0.09
234	0.09
235	0.08
236	0.07
237	0.07
238	0.07
239	0.07
240	0.09
241	0.11
242	0.12
243	0.13
244	0.13
245	0.13
246	0.15
247	0.15
248	0.12
249	0.13
250	0.12
251	0.17
252	0.17
253	0.16
254	0.15
255	0.16
256	0.18
257	0.16
258	0.18
259	0.14
260	0.16
261	0.19
262	0.2
263	0.21
264	0.23
265	0.25
266	0.26
267	0.28
268	0.29
269	0.29
270	0.28
271	0.27
272	0.28
273	0.31
274	0.29
275	0.26
276	0.26
277	0.24
278	0.23
279	0.21
280	0.18
281	0.11
282	0.1
283	0.1
284	0.08
285	0.07
286	0.07
287	0.07
288	0.06
289	0.06
290	0.05
291	0.05
292	0.05
293	0.05
294	0.05
295	0.06
296	0.06
297	0.13
298	0.17
299	0.18
300	0.24
301	0.26
302	0.27
303	0.28
304	0.28
305	0.26
306	0.29
307	0.3
308	0.26
309	0.24
310	0.23
311	0.22
312	0.21
313	0.17
314	0.11
315	0.08
316	0.07
317	0.07
318	0.08
319	0.1
320	0.15
321	0.16
322	0.18
323	0.19
324	0.2
325	0.23
326	0.23
327	0.21
328	0.17
329	0.19
330	0.17
331	0.16
332	0.16
333	0.12
334	0.12
335	0.12
336	0.15
337	0.16
338	0.19
339	0.22
340	0.28
341	0.35
342	0.41
343	0.43
344	0.45
345	0.41
346	0.4
347	0.38
348	0.34
349	0.29
350	0.26
351	0.25
352	0.19
353	0.18
354	0.16
355	0.15
356	0.12
357	0.11
358	0.08
359	0.06
360	0.07
361	0.09
362	0.09
363	0.11
364	0.11
365	0.11
366	0.15
367	0.15
368	0.18
369	0.24
370	0.26
371	0.25
372	0.27
373	0.27
374	0.24
375	0.29
376	0.3
377	0.23
378	0.31
379	0.33
380	0.33
381	0.39
382	0.4
383	0.36
384	0.4
385	0.48
386	0.39
387	0.37
388	0.37
389	0.37
390	0.36
391	0.34
392	0.28
393	0.2
394	0.19
395	0.22
396	0.23
397	0.18
398	0.19
399	0.19
400	0.17
401	0.18
402	0.17
403	0.13
404	0.1
405	0.09
406	0.08
407	0.07
408	0.07
409	0.05
410	0.05
411	0.05
412	0.05
413	0.05
414	0.08
415	0.08
416	0.11
417	0.13
418	0.15
419	0.16
420	0.17
421	0.19
422	0.22
423	0.26
424	0.35
425	0.44
426	0.5
427	0.58
428	0.67
429	0.75
430	0.78
431	0.81
432	0.81
433	0.81
434	0.83
435	0.85
436	0.85
437	0.86
438	0.87
439	0.89
440	0.88
441	0.86
442	0.85
443	0.84
444	0.84
445	0.83
446	0.83
447	0.84
448	0.84
449	0.86
450	0.88
451	0.88
452	0.84
453	0.79
454	0.74
455	0.74
456	0.74
457	0.73
458	0.72
459	0.7
460	0.72

A0A369GZK7

3D AlphaFold-predicted Structure Viewer