Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DK54

Protein Details
Accession A1DK54    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-56LSSPFRLIRKSRRTSPRRSFHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
KEGG nfi:NFIA_004510  -  
Amino Acid Sequences MVSSAPEFHVREVAAAAPDLISLAENRESSWINKHILSSPFRLIRKSRRTSPRRSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.07
5 0.07
6 0.06
7 0.05
8 0.04
9 0.04
10 0.05
11 0.07
12 0.08
13 0.08
14 0.1
15 0.11
16 0.11
17 0.16
18 0.18
19 0.17
20 0.18
21 0.19
22 0.23
23 0.27
24 0.29
25 0.28
26 0.31
27 0.36
28 0.37
29 0.4
30 0.42
31 0.48
32 0.55
33 0.6
34 0.64
35 0.68
36 0.75