Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HBC6

Protein Details
Accession A0A369HBC6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
540-590KEGQQNSKTSRKRKPSESWSGKHEKDESRLLRREKRHRKRDAQRRAEMSSEBasic
NLS Segment(s)
PositionSequence
547-584KTSRKRKPSESWSGKHEKDESRLLRREKRHRKRDAQRR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.833, cyto 8, cyto_mito 6.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR025313  DUF4217  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR000629  RNA-helicase_DEAD-box_CS  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00270  DEAD  
PF13959  DUF4217  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS00039  DEAD_ATP_HELICASE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17960  DEADc_DDX55  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MVPLSKKDSRAWTALTPPLAEWILEAVSSMGFAQMTPVQAATIPHLAGNKDVVAVTGSGKTLAYLIPAVQRLLRLDEPPKRHHVAAIIVSPTRELAAQIHTVLISLLRFHPPSAELLPCLDSDEKRPLTSHPVVIPQLLVGGTTTPAQDLAFFLRHSPNLLIASPGRLVELLSSPHVHCPQSSFDLLILDEADRLLDLGFKQHLQGIISRLPKQRRTGLFSASVGEAVTEIIRVGLRNPVKIEVRVRIKDGGLVQERKIPASLQMTYTIKPASQKLPALCRLLQQLPVTPQRSIVFLSSCAAVDYFQNVLPALLPPAFSLVCLHGKHPAKVRDKNFTRFLSSVSPTILLTTDLAARGLDIPQVDLVVQIDPPSDPKAFIHRSGRAGRAGRKGLAVVMLHPGREEDYVRFLEVRKTPVLPLDPDLDLDISPSDASAATETIRSIVKSDRALYDKAQRAFVSWVRSHGAHHATSIFRVADLDWPDLAEAWGLLRMPKMPELRHWEGDRFLGLDIDWHAFAYKDVARETARKAALQEQEEGGKEGQQNSKTSRKRKPSESWSGKHEKDESRLLRREKRHRKRDAQRRAEMSSEELARESELQRLIDQVRRRNQAPSGVDDDDDEFHGFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.4
4 0.34
5 0.34
6 0.3
7 0.25
8 0.18
9 0.15
10 0.13
11 0.12
12 0.12
13 0.08
14 0.07
15 0.07
16 0.07
17 0.06
18 0.05
19 0.05
20 0.09
21 0.1
22 0.12
23 0.12
24 0.12
25 0.11
26 0.13
27 0.14
28 0.15
29 0.16
30 0.15
31 0.16
32 0.19
33 0.19
34 0.19
35 0.2
36 0.16
37 0.14
38 0.14
39 0.12
40 0.11
41 0.11
42 0.12
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.1
53 0.14
54 0.15
55 0.16
56 0.16
57 0.18
58 0.18
59 0.23
60 0.24
61 0.24
62 0.32
63 0.39
64 0.45
65 0.49
66 0.55
67 0.53
68 0.51
69 0.49
70 0.44
71 0.43
72 0.41
73 0.39
74 0.35
75 0.31
76 0.3
77 0.28
78 0.24
79 0.18
80 0.14
81 0.1
82 0.09
83 0.12
84 0.14
85 0.14
86 0.14
87 0.13
88 0.13
89 0.12
90 0.11
91 0.08
92 0.08
93 0.1
94 0.14
95 0.15
96 0.15
97 0.16
98 0.16
99 0.2
100 0.21
101 0.21
102 0.17
103 0.18
104 0.2
105 0.18
106 0.2
107 0.19
108 0.16
109 0.19
110 0.27
111 0.27
112 0.27
113 0.28
114 0.27
115 0.34
116 0.36
117 0.36
118 0.3
119 0.34
120 0.34
121 0.33
122 0.31
123 0.22
124 0.19
125 0.15
126 0.12
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.06
133 0.07
134 0.07
135 0.07
136 0.08
137 0.1
138 0.12
139 0.12
140 0.14
141 0.17
142 0.17
143 0.19
144 0.19
145 0.18
146 0.18
147 0.18
148 0.18
149 0.15
150 0.17
151 0.16
152 0.15
153 0.12
154 0.1
155 0.1
156 0.09
157 0.11
158 0.1
159 0.11
160 0.13
161 0.14
162 0.19
163 0.22
164 0.21
165 0.19
166 0.2
167 0.22
168 0.24
169 0.24
170 0.2
171 0.17
172 0.18
173 0.17
174 0.15
175 0.11
176 0.07
177 0.07
178 0.06
179 0.05
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.07
186 0.09
187 0.09
188 0.1
189 0.11
190 0.13
191 0.12
192 0.14
193 0.16
194 0.2
195 0.24
196 0.3
197 0.35
198 0.4
199 0.44
200 0.47
201 0.52
202 0.51
203 0.55
204 0.52
205 0.49
206 0.46
207 0.41
208 0.38
209 0.29
210 0.25
211 0.17
212 0.13
213 0.09
214 0.06
215 0.06
216 0.04
217 0.04
218 0.04
219 0.04
220 0.05
221 0.05
222 0.12
223 0.13
224 0.15
225 0.16
226 0.2
227 0.21
228 0.24
229 0.27
230 0.28
231 0.34
232 0.34
233 0.35
234 0.33
235 0.31
236 0.31
237 0.29
238 0.28
239 0.27
240 0.27
241 0.26
242 0.28
243 0.29
244 0.26
245 0.25
246 0.19
247 0.16
248 0.18
249 0.18
250 0.15
251 0.19
252 0.2
253 0.2
254 0.21
255 0.18
256 0.15
257 0.16
258 0.17
259 0.16
260 0.18
261 0.21
262 0.22
263 0.27
264 0.31
265 0.32
266 0.3
267 0.29
268 0.29
269 0.27
270 0.28
271 0.23
272 0.22
273 0.23
274 0.29
275 0.29
276 0.25
277 0.26
278 0.22
279 0.23
280 0.21
281 0.18
282 0.12
283 0.11
284 0.12
285 0.1
286 0.09
287 0.08
288 0.07
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.06
298 0.06
299 0.06
300 0.05
301 0.05
302 0.05
303 0.07
304 0.07
305 0.06
306 0.07
307 0.08
308 0.12
309 0.13
310 0.13
311 0.19
312 0.21
313 0.24
314 0.3
315 0.37
316 0.4
317 0.48
318 0.51
319 0.54
320 0.58
321 0.61
322 0.61
323 0.54
324 0.5
325 0.42
326 0.41
327 0.35
328 0.31
329 0.26
330 0.2
331 0.19
332 0.15
333 0.15
334 0.13
335 0.08
336 0.07
337 0.07
338 0.07
339 0.06
340 0.06
341 0.06
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.06
348 0.06
349 0.06
350 0.06
351 0.05
352 0.05
353 0.05
354 0.05
355 0.05
356 0.05
357 0.05
358 0.07
359 0.09
360 0.09
361 0.09
362 0.1
363 0.18
364 0.2
365 0.25
366 0.3
367 0.31
368 0.36
369 0.39
370 0.41
371 0.39
372 0.41
373 0.42
374 0.43
375 0.41
376 0.37
377 0.33
378 0.31
379 0.26
380 0.24
381 0.18
382 0.12
383 0.16
384 0.15
385 0.14
386 0.14
387 0.14
388 0.12
389 0.14
390 0.14
391 0.09
392 0.13
393 0.14
394 0.15
395 0.15
396 0.15
397 0.2
398 0.21
399 0.24
400 0.21
401 0.22
402 0.22
403 0.25
404 0.27
405 0.22
406 0.21
407 0.21
408 0.19
409 0.18
410 0.18
411 0.15
412 0.12
413 0.11
414 0.09
415 0.06
416 0.06
417 0.05
418 0.05
419 0.05
420 0.05
421 0.05
422 0.06
423 0.06
424 0.07
425 0.07
426 0.08
427 0.09
428 0.08
429 0.09
430 0.12
431 0.16
432 0.18
433 0.2
434 0.23
435 0.26
436 0.28
437 0.29
438 0.35
439 0.38
440 0.38
441 0.39
442 0.34
443 0.33
444 0.36
445 0.36
446 0.34
447 0.28
448 0.29
449 0.28
450 0.28
451 0.27
452 0.29
453 0.3
454 0.23
455 0.23
456 0.24
457 0.22
458 0.22
459 0.23
460 0.17
461 0.13
462 0.13
463 0.12
464 0.14
465 0.17
466 0.18
467 0.15
468 0.15
469 0.15
470 0.15
471 0.14
472 0.09
473 0.06
474 0.05
475 0.06
476 0.06
477 0.07
478 0.07
479 0.09
480 0.11
481 0.17
482 0.22
483 0.22
484 0.29
485 0.38
486 0.44
487 0.48
488 0.49
489 0.46
490 0.43
491 0.43
492 0.36
493 0.28
494 0.22
495 0.15
496 0.12
497 0.11
498 0.12
499 0.12
500 0.11
501 0.1
502 0.1
503 0.1
504 0.1
505 0.13
506 0.13
507 0.14
508 0.15
509 0.18
510 0.21
511 0.25
512 0.28
513 0.32
514 0.31
515 0.3
516 0.31
517 0.36
518 0.4
519 0.38
520 0.37
521 0.31
522 0.33
523 0.32
524 0.32
525 0.25
526 0.22
527 0.23
528 0.25
529 0.3
530 0.31
531 0.34
532 0.38
533 0.48
534 0.52
535 0.59
536 0.64
537 0.69
538 0.74
539 0.79
540 0.83
541 0.83
542 0.86
543 0.87
544 0.81
545 0.79
546 0.81
547 0.73
548 0.69
549 0.66
550 0.6
551 0.56
552 0.61
553 0.6
554 0.6
555 0.66
556 0.69
557 0.71
558 0.75
559 0.81
560 0.82
561 0.85
562 0.86
563 0.89
564 0.92
565 0.93
566 0.94
567 0.94
568 0.93
569 0.92
570 0.87
571 0.8
572 0.73
573 0.64
574 0.57
575 0.51
576 0.42
577 0.33
578 0.28
579 0.24
580 0.22
581 0.24
582 0.2
583 0.2
584 0.21
585 0.22
586 0.21
587 0.26
588 0.29
589 0.32
590 0.39
591 0.43
592 0.49
593 0.54
594 0.56
595 0.57
596 0.58
597 0.6
598 0.57
599 0.54
600 0.51
601 0.46
602 0.44
603 0.39
604 0.37
605 0.29
606 0.27
607 0.22