Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369H534

Protein Details
Accession A0A369H534    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
50-72DIESRRRRLFHGKKKSQEKTHETBasic
NLS Segment(s)
PositionSequence
56-63RRLFHGKK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.5, cyto 10.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRIPEDIMLGGHCAMYNPTEILIETASYATPPLCPAPTNKAMICTNCLSDIESRRRRLFHGKKKSQEKTHETDQHKVCDRHAQLGVVCKLCHPPDGHGRRKDNGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.08
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.07
16 0.06
17 0.06
18 0.07
19 0.08
20 0.09
21 0.09
22 0.12
23 0.19
24 0.23
25 0.26
26 0.24
27 0.27
28 0.29
29 0.29
30 0.29
31 0.23
32 0.2
33 0.17
34 0.18
35 0.14
36 0.15
37 0.21
38 0.27
39 0.32
40 0.35
41 0.37
42 0.38
43 0.4
44 0.48
45 0.52
46 0.53
47 0.59
48 0.64
49 0.71
50 0.8
51 0.85
52 0.82
53 0.81
54 0.77
55 0.72
56 0.73
57 0.73
58 0.66
59 0.67
60 0.62
61 0.6
62 0.61
63 0.55
64 0.47
65 0.47
66 0.45
67 0.43
68 0.41
69 0.36
70 0.3
71 0.37
72 0.4
73 0.33
74 0.31
75 0.26
76 0.3
77 0.29
78 0.32
79 0.25
80 0.27
81 0.36
82 0.45
83 0.54
84 0.58
85 0.62
86 0.65