Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HEE4

Protein Details
Accession A0A369HEE4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
125-144DYPEKKKEDKPYKPDTPYKPBasic
NLS Segment(s)
Subcellular Location(s) extr 9, E.R. 6, cyto 5.5, cyto_nucl 4, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038843  Sed1/Spi1  
Gene Ontology GO:0016020  C:membrane  
GO:0005199  F:structural constituent of cell wall  
GO:0031505  P:fungal-type cell wall organization  
Amino Acid Sequences MFAKTAIVAAFAGLAASQYTSSASNYGGYGDDTDEYGTSSYKPVPTTTKVVDQYVTYCPVPTVITMNEKYYTVTEPTTYTINDCPCTVTEPCYTCAPTAPAYQPEPTKESYPEEKKEDYPEKKEDYPEKKKEDKPYKPDTPYKPDTKKPIEVAGADARHVAYGLAMAFAGLVGYVALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.09
9 0.09
10 0.1
11 0.1
12 0.1
13 0.11
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.08
26 0.09
27 0.11
28 0.13
29 0.14
30 0.16
31 0.21
32 0.24
33 0.29
34 0.3
35 0.35
36 0.35
37 0.35
38 0.33
39 0.29
40 0.27
41 0.25
42 0.25
43 0.18
44 0.15
45 0.14
46 0.14
47 0.14
48 0.12
49 0.12
50 0.1
51 0.15
52 0.16
53 0.18
54 0.18
55 0.17
56 0.18
57 0.16
58 0.16
59 0.13
60 0.12
61 0.11
62 0.11
63 0.12
64 0.13
65 0.12
66 0.12
67 0.13
68 0.14
69 0.14
70 0.13
71 0.13
72 0.12
73 0.16
74 0.14
75 0.15
76 0.16
77 0.17
78 0.19
79 0.19
80 0.2
81 0.16
82 0.17
83 0.16
84 0.14
85 0.15
86 0.15
87 0.16
88 0.17
89 0.2
90 0.2
91 0.21
92 0.21
93 0.21
94 0.21
95 0.2
96 0.23
97 0.29
98 0.34
99 0.37
100 0.39
101 0.39
102 0.39
103 0.45
104 0.5
105 0.48
106 0.47
107 0.48
108 0.49
109 0.49
110 0.54
111 0.55
112 0.56
113 0.6
114 0.62
115 0.65
116 0.68
117 0.72
118 0.77
119 0.79
120 0.78
121 0.76
122 0.78
123 0.79
124 0.78
125 0.8
126 0.77
127 0.75
128 0.73
129 0.75
130 0.72
131 0.7
132 0.73
133 0.71
134 0.7
135 0.64
136 0.62
137 0.55
138 0.48
139 0.46
140 0.44
141 0.37
142 0.31
143 0.29
144 0.23
145 0.19
146 0.19
147 0.13
148 0.06
149 0.07
150 0.06
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.03
158 0.03