Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CZG2

Protein Details
Accession A1CZG2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-57HKSFRTKQKLAKAQRQNRPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.833, cyto 3.5, cyto_pero 2.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nfi:NFIA_037040  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MDDRTRDIVSNKNQRAVVAYHCYQMWSLVVDTEPDSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.4
4 0.36
5 0.32
6 0.3
7 0.25
8 0.25
9 0.25
10 0.22
11 0.2
12 0.15
13 0.1
14 0.08
15 0.07
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.13
23 0.13
24 0.15
25 0.2
26 0.27
27 0.35
28 0.43
29 0.47
30 0.52
31 0.62
32 0.7
33 0.73
34 0.76
35 0.77
36 0.78
37 0.8
38 0.82
39 0.79
40 0.78
41 0.76
42 0.75
43 0.69
44 0.68
45 0.68
46 0.64
47 0.64
48 0.6
49 0.57