Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369H7M5

Protein Details
Accession A0A369H7M5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-73IRTKEGRKILARRRAKGRRELGBasic
NLS Segment(s)
PositionSequence
43-73KRRHGFLSRIRTKEGRKILARRRAKGRRELG
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MDSSACADVVPRSAVSSHPALASLQLRFGPRNTMVRATRLVQKRRHGFLSRIRTKEGRKILARRRAKGRRELGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.15
5 0.14
6 0.14
7 0.13
8 0.16
9 0.17
10 0.14
11 0.13
12 0.15
13 0.16
14 0.16
15 0.17
16 0.18
17 0.18
18 0.22
19 0.23
20 0.27
21 0.26
22 0.28
23 0.29
24 0.27
25 0.31
26 0.34
27 0.4
28 0.4
29 0.48
30 0.52
31 0.53
32 0.58
33 0.54
34 0.52
35 0.55
36 0.6
37 0.6
38 0.56
39 0.56
40 0.56
41 0.56
42 0.6
43 0.58
44 0.55
45 0.55
46 0.62
47 0.68
48 0.73
49 0.77
50 0.76
51 0.79
52 0.8
53 0.8
54 0.8
55 0.78