Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369HM45

Protein Details
Accession A0A369HM45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-113ATYNPSKRIKQSRNEVPESPHydrophilic
NLS Segment(s)
PositionSequence
22-47ARKVIGGKTVLSKRHRRLARRGGVKR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MAPTKSSRGGPAAARALPSNIARKVIGGKTVLSKRHRRLARRGGVKRISAGIYDEILQSCVIYVEYRNAKTITTLDVIHSLARLGRPVYGFDPATYNPSKRIKQSRNEVPESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.27
5 0.28
6 0.28
7 0.24
8 0.25
9 0.24
10 0.24
11 0.28
12 0.26
13 0.26
14 0.2
15 0.2
16 0.26
17 0.31
18 0.37
19 0.39
20 0.46
21 0.49
22 0.57
23 0.62
24 0.61
25 0.66
26 0.69
27 0.71
28 0.73
29 0.73
30 0.73
31 0.71
32 0.65
33 0.56
34 0.47
35 0.38
36 0.28
37 0.24
38 0.16
39 0.12
40 0.11
41 0.11
42 0.08
43 0.08
44 0.08
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.09
52 0.13
53 0.14
54 0.16
55 0.16
56 0.16
57 0.17
58 0.18
59 0.15
60 0.13
61 0.13
62 0.12
63 0.13
64 0.14
65 0.13
66 0.12
67 0.09
68 0.09
69 0.09
70 0.1
71 0.09
72 0.11
73 0.11
74 0.14
75 0.15
76 0.19
77 0.19
78 0.18
79 0.21
80 0.19
81 0.24
82 0.25
83 0.25
84 0.28
85 0.36
86 0.39
87 0.45
88 0.55
89 0.58
90 0.65
91 0.74
92 0.77
93 0.78