Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HLA5

Protein Details
Accession A0A369HLA5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-82AEAARRRCPKKYHRHQGKCCRRRKLRRTYYDCHPWBasic
NLS Segment(s)
Subcellular Location(s) extr 14, plas 4, mito 3, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRVTQLIVAAFVTLSVSATPVANTDQAEIDVRAVNDIQAEPLVAREEAEAARRRCPKKYHRHQGKCCRRRKLRRTYYDCHPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.07
8 0.08
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.12
15 0.11
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.05
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.11
36 0.18
37 0.18
38 0.26
39 0.34
40 0.37
41 0.42
42 0.51
43 0.56
44 0.61
45 0.71
46 0.76
47 0.79
48 0.87
49 0.92
50 0.94
51 0.95
52 0.94
53 0.92
54 0.91
55 0.91
56 0.91
57 0.91
58 0.91
59 0.91
60 0.92
61 0.92
62 0.87