Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HCT9

Protein Details
Accession A0A369HCT9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-49KKHVPIVKKRTARFNRHQSDRFKCLSPSWRKPKGIDNRVRRRFRGBasic
NLS Segment(s)
PositionSequence
35-38KPKG
44-44R
Subcellular Location(s) mito 16.5, mito_nucl 11.833, nucl 6, cyto_nucl 5.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTARFNRHQSDRFKCLSPSWRKPKGIDNRVRRRFRGTMAMPSIGYGSNKKTRYMMPSGHKAFLVNNVKDVELLMMHNRTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.78
4 0.79
5 0.81
6 0.81
7 0.82
8 0.85
9 0.83
10 0.81
11 0.77
12 0.7
13 0.62
14 0.54
15 0.5
16 0.53
17 0.55
18 0.57
19 0.61
20 0.66
21 0.67
22 0.67
23 0.71
24 0.71
25 0.72
26 0.71
27 0.71
28 0.74
29 0.81
30 0.83
31 0.76
32 0.72
33 0.64
34 0.58
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.35
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.19
48 0.2
49 0.21
50 0.22
51 0.23
52 0.27
53 0.3
54 0.33
55 0.31
56 0.38
57 0.4
58 0.39
59 0.37
60 0.32
61 0.28
62 0.31
63 0.34
64 0.25
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37