Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HG18

Protein Details
Accession A0A369HG18   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRMRMRAVDDVHydrophilic
76-105DKYTMFDRKAKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKKYRKGIHKLPK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRITNVLSGGLLWKIPWRLSKFQKRRHRMRMRAVDDVVSTISSALEAQGQKLTSLERWKEEMPTEQEMLPRDKYTMFDRKAKKYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.12
5 0.13
6 0.16
7 0.23
8 0.28
9 0.36
10 0.46
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.6
26 0.49
27 0.4
28 0.3
29 0.19
30 0.13
31 0.07
32 0.06
33 0.05
34 0.04
35 0.04
36 0.06
37 0.06
38 0.07
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.09
45 0.15
46 0.16
47 0.16
48 0.19
49 0.2
50 0.21
51 0.22
52 0.25
53 0.24
54 0.25
55 0.25
56 0.23
57 0.25
58 0.25
59 0.27
60 0.23
61 0.2
62 0.18
63 0.17
64 0.19
65 0.23
66 0.3
67 0.31
68 0.38
69 0.44
70 0.53
71 0.63
72 0.69
73 0.72
74 0.73
75 0.79
76 0.82
77 0.85
78 0.85
79 0.87
80 0.87
81 0.88
82 0.87
83 0.87
84 0.82
85 0.81
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79