Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369H715

Protein Details
Accession A0A369H715   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
93-121TVARHLRNSDERRRRQQQRKPHQRSSTTFHydrophilic
204-228VVGAGRPRLRRRHRHHPYHGRVSLFBasic
NLS Segment(s)
PositionSequence
209-217RPRLRRRHR
Subcellular Location(s) mito 14, extr 6, cyto 3.5, cyto_nucl 2.5, plas 2
Family & Domain DBs
Amino Acid Sequences MASLRLTRLPSGGLLALVSRVGRGRFAVMLWRERLVGIVDGIMSRGLVSVVNSSVFGNSASFKRVVDENEEVVEFRDADYETVLLEGILVRLTVARHLRNSDERRRRQQQRKPHQRSSTTFHDLSWNKFLAQDGHDKDDNNNDGLPQFILPLPDKMAVDDAAYLRAKGALTIPSASLQSALLRAYAEFVHPYMPLLDLDDFLAVVGAGRPRLRRRHRHHPYHGRVSLFLYQAVAFASTAFVDMRHLHEAGFATRKAARKAFFQRTRVSRFFMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.1
5 0.1
6 0.08
7 0.11
8 0.11
9 0.13
10 0.13
11 0.15
12 0.15
13 0.16
14 0.23
15 0.25
16 0.3
17 0.3
18 0.3
19 0.28
20 0.27
21 0.28
22 0.21
23 0.18
24 0.12
25 0.11
26 0.1
27 0.09
28 0.1
29 0.09
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.1
47 0.12
48 0.13
49 0.13
50 0.15
51 0.17
52 0.18
53 0.22
54 0.23
55 0.22
56 0.22
57 0.23
58 0.2
59 0.19
60 0.18
61 0.12
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.05
80 0.09
81 0.13
82 0.15
83 0.17
84 0.19
85 0.23
86 0.32
87 0.39
88 0.46
89 0.52
90 0.58
91 0.66
92 0.74
93 0.81
94 0.82
95 0.83
96 0.84
97 0.85
98 0.89
99 0.88
100 0.88
101 0.85
102 0.81
103 0.77
104 0.73
105 0.69
106 0.63
107 0.54
108 0.45
109 0.46
110 0.4
111 0.38
112 0.35
113 0.28
114 0.22
115 0.22
116 0.22
117 0.16
118 0.16
119 0.2
120 0.18
121 0.21
122 0.23
123 0.22
124 0.23
125 0.25
126 0.25
127 0.18
128 0.16
129 0.13
130 0.12
131 0.12
132 0.11
133 0.06
134 0.06
135 0.06
136 0.08
137 0.08
138 0.09
139 0.1
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.09
146 0.1
147 0.08
148 0.1
149 0.1
150 0.1
151 0.09
152 0.1
153 0.09
154 0.08
155 0.1
156 0.09
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.09
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.09
179 0.08
180 0.09
181 0.08
182 0.09
183 0.09
184 0.09
185 0.09
186 0.08
187 0.08
188 0.07
189 0.06
190 0.04
191 0.04
192 0.05
193 0.06
194 0.08
195 0.1
196 0.16
197 0.23
198 0.34
199 0.44
200 0.53
201 0.61
202 0.71
203 0.8
204 0.85
205 0.9
206 0.91
207 0.91
208 0.9
209 0.86
210 0.76
211 0.66
212 0.6
213 0.54
214 0.43
215 0.34
216 0.24
217 0.19
218 0.18
219 0.17
220 0.13
221 0.08
222 0.07
223 0.07
224 0.06
225 0.07
226 0.07
227 0.06
228 0.09
229 0.1
230 0.14
231 0.17
232 0.17
233 0.16
234 0.19
235 0.21
236 0.22
237 0.26
238 0.22
239 0.22
240 0.26
241 0.32
242 0.35
243 0.39
244 0.37
245 0.42
246 0.52
247 0.6
248 0.64
249 0.65
250 0.69
251 0.72
252 0.78
253 0.73