Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HEM9

Protein Details
Accession A0A369HEM9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
117-137LATLKNDNSKKDKKKGDEKKSBasic
NLS Segment(s)
PositionSequence
126-137KKDKKKGDEKKS
Subcellular Location(s) mito 17, cyto 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003746  DUF167  
IPR036591  YggU-like_sf  
Pfam View protein in Pfam  
PF02594  DUF167  
Amino Acid Sequences MATTSSAIRFIGPLNHKPPLMGVIQIHLHVNPGSSNIKLGVVKLLTADRIHINIGAQARDGAANLATIAFLAQITQLPPSRFSLRFGHRGREKTFEIQGVEAKTGPLLVKKFLNKFLATLKNDNSKKDKKKGDEKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.38
4 0.37
5 0.36
6 0.31
7 0.26
8 0.22
9 0.17
10 0.16
11 0.18
12 0.18
13 0.18
14 0.15
15 0.15
16 0.12
17 0.13
18 0.09
19 0.12
20 0.13
21 0.12
22 0.13
23 0.12
24 0.14
25 0.14
26 0.14
27 0.14
28 0.12
29 0.12
30 0.12
31 0.12
32 0.11
33 0.11
34 0.12
35 0.1
36 0.1
37 0.11
38 0.1
39 0.09
40 0.11
41 0.12
42 0.11
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.06
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.06
63 0.09
64 0.1
65 0.12
66 0.15
67 0.2
68 0.2
69 0.23
70 0.29
71 0.31
72 0.4
73 0.41
74 0.46
75 0.48
76 0.53
77 0.52
78 0.5
79 0.49
80 0.43
81 0.44
82 0.38
83 0.33
84 0.29
85 0.29
86 0.25
87 0.22
88 0.18
89 0.15
90 0.12
91 0.12
92 0.11
93 0.13
94 0.13
95 0.14
96 0.2
97 0.26
98 0.3
99 0.35
100 0.39
101 0.35
102 0.36
103 0.42
104 0.45
105 0.44
106 0.46
107 0.45
108 0.51
109 0.53
110 0.57
111 0.58
112 0.59
113 0.64
114 0.69
115 0.73
116 0.73
117 0.82