Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369H0R4

Protein Details
Accession A0A369H0R4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
71-90LTKKREWKLRERVRKSARRVBasic
NLS Segment(s)
PositionSequence
73-89KKREWKLRERVRKSARR
Subcellular Location(s) cyto 7.5, cyto_nucl 7.5, nucl 6.5, plas 6, extr 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAASEPQATHTTYEGDAGGGAAPGAQSGVDAGASGSNSGAMSLPTGGLVAIVVIVVAVCLIGATTTTLYFLTKKREWKLRERVRKSARRVASVLTPRRAQFPNSVRRPATSSLSGRAQSTDKVPSLSSHTRLDDLEKGKAQAQVRNKTDEPVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.1
5 0.09
6 0.06
7 0.06
8 0.04
9 0.04
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.04
16 0.03
17 0.03
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.02
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.07
57 0.1
58 0.16
59 0.2
60 0.26
61 0.31
62 0.39
63 0.43
64 0.5
65 0.59
66 0.63
67 0.7
68 0.7
69 0.75
70 0.77
71 0.81
72 0.78
73 0.76
74 0.69
75 0.62
76 0.57
77 0.49
78 0.47
79 0.47
80 0.46
81 0.4
82 0.4
83 0.36
84 0.41
85 0.4
86 0.35
87 0.35
88 0.38
89 0.44
90 0.47
91 0.52
92 0.48
93 0.48
94 0.5
95 0.44
96 0.41
97 0.36
98 0.33
99 0.31
100 0.35
101 0.34
102 0.31
103 0.3
104 0.27
105 0.22
106 0.23
107 0.24
108 0.2
109 0.21
110 0.21
111 0.2
112 0.27
113 0.31
114 0.32
115 0.31
116 0.32
117 0.32
118 0.32
119 0.35
120 0.34
121 0.32
122 0.34
123 0.32
124 0.32
125 0.34
126 0.39
127 0.37
128 0.37
129 0.43
130 0.47
131 0.49
132 0.55
133 0.52