Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369HFW1

Protein Details
Accession A0A369HFW1    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-104LKHSLQKIAKQPKKNPRNGGHydrophilic
238-257KVATLRSHKKENKSLPQPAVHydrophilic
NLS Segment(s)
PositionSequence
94-110KQPKKNPRNGGESARGS
120-125GPRGRR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR008676  MRG  
IPR025995  Tudor-knot  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF11717  Tudor-knot  
Amino Acid Sequences MPPTRQQQQAPPFSKDEKVLCFHMDMLYEAKIMEVQLRNKPGEGYRFKVHYKGWKSTWDDWVLADRIRPFDDEHKELAAQLHAQLKHSLQKIAKQPKKNPRNGGESARGSEERASSAAQGPRGRRGKDWELEQHEFPVSNVRGAPEEAPVVRLPIVGSPTTLSDGSSSDPTCRNFGHSSYRIPRSRMSQKWTIINDKRYREVKDHLTELPKPDHRYVSASGKILFDSRYCMVSQAPPKVATLRSHKKENKSLPQPAVEEEPKVEVSWDSQSPPIERSRVSGNSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.49
4 0.44
5 0.42
6 0.4
7 0.37
8 0.34
9 0.32
10 0.28
11 0.24
12 0.2
13 0.18
14 0.16
15 0.14
16 0.13
17 0.12
18 0.11
19 0.1
20 0.15
21 0.18
22 0.22
23 0.29
24 0.34
25 0.35
26 0.35
27 0.38
28 0.36
29 0.4
30 0.41
31 0.4
32 0.42
33 0.46
34 0.46
35 0.48
36 0.49
37 0.49
38 0.5
39 0.52
40 0.49
41 0.52
42 0.58
43 0.59
44 0.61
45 0.54
46 0.47
47 0.41
48 0.42
49 0.35
50 0.29
51 0.26
52 0.21
53 0.2
54 0.21
55 0.21
56 0.19
57 0.26
58 0.32
59 0.32
60 0.32
61 0.31
62 0.3
63 0.29
64 0.28
65 0.2
66 0.14
67 0.14
68 0.18
69 0.17
70 0.19
71 0.2
72 0.2
73 0.25
74 0.26
75 0.29
76 0.24
77 0.3
78 0.38
79 0.48
80 0.53
81 0.56
82 0.64
83 0.69
84 0.78
85 0.8
86 0.79
87 0.74
88 0.75
89 0.71
90 0.67
91 0.64
92 0.55
93 0.48
94 0.43
95 0.37
96 0.3
97 0.27
98 0.21
99 0.15
100 0.14
101 0.13
102 0.11
103 0.15
104 0.16
105 0.19
106 0.22
107 0.22
108 0.3
109 0.35
110 0.36
111 0.33
112 0.38
113 0.41
114 0.41
115 0.44
116 0.43
117 0.44
118 0.46
119 0.44
120 0.38
121 0.31
122 0.27
123 0.23
124 0.22
125 0.15
126 0.14
127 0.14
128 0.13
129 0.13
130 0.14
131 0.14
132 0.08
133 0.09
134 0.08
135 0.09
136 0.09
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.09
143 0.07
144 0.08
145 0.08
146 0.08
147 0.1
148 0.09
149 0.08
150 0.07
151 0.08
152 0.09
153 0.11
154 0.11
155 0.11
156 0.15
157 0.16
158 0.18
159 0.17
160 0.2
161 0.2
162 0.22
163 0.29
164 0.28
165 0.34
166 0.38
167 0.47
168 0.45
169 0.46
170 0.46
171 0.46
172 0.53
173 0.52
174 0.51
175 0.5
176 0.51
177 0.56
178 0.58
179 0.59
180 0.56
181 0.59
182 0.6
183 0.56
184 0.59
185 0.57
186 0.56
187 0.51
188 0.5
189 0.5
190 0.47
191 0.47
192 0.44
193 0.45
194 0.44
195 0.43
196 0.45
197 0.41
198 0.42
199 0.42
200 0.4
201 0.37
202 0.39
203 0.39
204 0.39
205 0.38
206 0.35
207 0.33
208 0.31
209 0.3
210 0.27
211 0.24
212 0.17
213 0.17
214 0.16
215 0.16
216 0.16
217 0.16
218 0.17
219 0.23
220 0.29
221 0.31
222 0.32
223 0.32
224 0.33
225 0.36
226 0.38
227 0.37
228 0.41
229 0.45
230 0.48
231 0.58
232 0.64
233 0.69
234 0.75
235 0.79
236 0.79
237 0.78
238 0.81
239 0.75
240 0.74
241 0.66
242 0.59
243 0.57
244 0.48
245 0.4
246 0.32
247 0.31
248 0.26
249 0.24
250 0.22
251 0.15
252 0.16
253 0.2
254 0.2
255 0.19
256 0.22
257 0.26
258 0.27
259 0.3
260 0.32
261 0.31
262 0.3
263 0.31
264 0.35
265 0.4