Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GL62

Protein Details
Accession A0A369GL62    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
25-60ALELRPPSWDERRRRRGCRRQQRRRRSSSSSIKGARHydrophilic
NLS Segment(s)
PositionSequence
36-54RRRRRGCRRQQRRRRSSSS
Subcellular Location(s) cyto 14, mito 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MTRLKELPPIWQQPSLSTLVKTLEALELRPPSWDERRRRRGCRRQQRRRRSSSSSIKGARGVMEKETRYLATIIKSPLGWISEDDSERERVWELASKRMAERCGRTAMGDVVRPWLVGDAVELVIAEPGLTGDEALGLKTWASSFVLARQLTRLADVIGVETESRPSPRVLELGAGTGLLGLAAAALWRTEVVVSDLPRIVPNLRKNVEKNASLIRARGGSVAVGSLTWGGGEEDDETLFGEPFQFDVVLAADPLYDDHHPRLLASAIHGQLARGGKSARAVVMVPKRDAATMKLLDDFGREMAELDMFCYRQEELLGRDDWGTVEDYEDEDEDGDGDEDGEVREEDGDEKNVVRCWLGLFSRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.36
4 0.28
5 0.26
6 0.24
7 0.24
8 0.22
9 0.19
10 0.2
11 0.18
12 0.19
13 0.22
14 0.24
15 0.23
16 0.25
17 0.25
18 0.27
19 0.36
20 0.44
21 0.49
22 0.57
23 0.68
24 0.76
25 0.85
26 0.9
27 0.91
28 0.93
29 0.94
30 0.94
31 0.95
32 0.96
33 0.97
34 0.96
35 0.95
36 0.92
37 0.9
38 0.89
39 0.89
40 0.86
41 0.84
42 0.78
43 0.7
44 0.64
45 0.56
46 0.49
47 0.43
48 0.36
49 0.32
50 0.34
51 0.33
52 0.31
53 0.32
54 0.29
55 0.26
56 0.25
57 0.22
58 0.18
59 0.22
60 0.21
61 0.21
62 0.2
63 0.19
64 0.2
65 0.18
66 0.16
67 0.13
68 0.15
69 0.18
70 0.18
71 0.2
72 0.2
73 0.21
74 0.2
75 0.2
76 0.18
77 0.14
78 0.15
79 0.2
80 0.19
81 0.25
82 0.27
83 0.28
84 0.3
85 0.33
86 0.36
87 0.34
88 0.37
89 0.33
90 0.34
91 0.33
92 0.31
93 0.29
94 0.29
95 0.26
96 0.23
97 0.2
98 0.19
99 0.18
100 0.18
101 0.16
102 0.12
103 0.1
104 0.08
105 0.07
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.05
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.1
133 0.16
134 0.16
135 0.16
136 0.16
137 0.18
138 0.17
139 0.17
140 0.14
141 0.08
142 0.09
143 0.08
144 0.08
145 0.06
146 0.06
147 0.05
148 0.05
149 0.06
150 0.06
151 0.07
152 0.08
153 0.08
154 0.09
155 0.1
156 0.11
157 0.1
158 0.11
159 0.1
160 0.1
161 0.09
162 0.08
163 0.07
164 0.06
165 0.05
166 0.03
167 0.03
168 0.02
169 0.01
170 0.01
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.03
179 0.05
180 0.08
181 0.08
182 0.1
183 0.11
184 0.11
185 0.11
186 0.12
187 0.12
188 0.16
189 0.2
190 0.27
191 0.29
192 0.33
193 0.34
194 0.42
195 0.45
196 0.4
197 0.37
198 0.34
199 0.36
200 0.33
201 0.31
202 0.24
203 0.2
204 0.19
205 0.17
206 0.13
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.06
232 0.05
233 0.04
234 0.05
235 0.06
236 0.05
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.07
243 0.07
244 0.09
245 0.11
246 0.13
247 0.13
248 0.13
249 0.15
250 0.14
251 0.13
252 0.14
253 0.19
254 0.17
255 0.18
256 0.18
257 0.17
258 0.2
259 0.21
260 0.19
261 0.15
262 0.15
263 0.15
264 0.17
265 0.18
266 0.15
267 0.14
268 0.14
269 0.19
270 0.27
271 0.3
272 0.28
273 0.29
274 0.29
275 0.29
276 0.3
277 0.25
278 0.25
279 0.23
280 0.23
281 0.23
282 0.23
283 0.22
284 0.22
285 0.2
286 0.13
287 0.12
288 0.1
289 0.1
290 0.1
291 0.11
292 0.09
293 0.1
294 0.12
295 0.11
296 0.11
297 0.12
298 0.12
299 0.11
300 0.13
301 0.14
302 0.14
303 0.19
304 0.2
305 0.2
306 0.2
307 0.19
308 0.18
309 0.17
310 0.16
311 0.11
312 0.11
313 0.11
314 0.11
315 0.12
316 0.13
317 0.11
318 0.1
319 0.1
320 0.08
321 0.09
322 0.08
323 0.07
324 0.06
325 0.06
326 0.06
327 0.07
328 0.08
329 0.07
330 0.07
331 0.08
332 0.08
333 0.1
334 0.13
335 0.15
336 0.15
337 0.17
338 0.19
339 0.21
340 0.22
341 0.2
342 0.18
343 0.18
344 0.23
345 0.23