Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GG61

Protein Details
Accession A0A369GG61   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-66VTWHLRFSRRARQARREKNQAAKKGRAHydrophilic
NLS Segment(s)
PositionSequence
48-65RRARQARREKNQAAKKGR
Subcellular Location(s) extr 15, mito 9, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAIIPAPTTESSNASGTPTPVAIAVALTTTAGVAIVLALVTWHLRFSRRARQARREKNQAAKKGRAQPDSPTPLVSSSPTTPTPVPDGLLLTPPRRLQERKLLLDACSPRTTTTTTTAVAAPVQDRNWPAPPPDSTRSSEATVTSARAESPHQRSLPPPPPVSRSGTPSDPSPASQGPTRQYHRPLTGLTKCPGPPPSRALPPTPRDTHPRTIGPTPPPPSPTSPAPAPRGTADGAICRPLLQEGELEQLGGSYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.2
5 0.17
6 0.14
7 0.13
8 0.13
9 0.09
10 0.08
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.03
27 0.04
28 0.04
29 0.06
30 0.07
31 0.1
32 0.17
33 0.24
34 0.34
35 0.44
36 0.54
37 0.61
38 0.71
39 0.8
40 0.85
41 0.87
42 0.87
43 0.85
44 0.85
45 0.85
46 0.84
47 0.81
48 0.77
49 0.76
50 0.75
51 0.75
52 0.7
53 0.63
54 0.58
55 0.6
56 0.59
57 0.51
58 0.43
59 0.35
60 0.32
61 0.31
62 0.26
63 0.2
64 0.15
65 0.18
66 0.18
67 0.2
68 0.19
69 0.2
70 0.22
71 0.19
72 0.18
73 0.15
74 0.16
75 0.13
76 0.18
77 0.18
78 0.16
79 0.18
80 0.19
81 0.2
82 0.24
83 0.26
84 0.26
85 0.35
86 0.41
87 0.42
88 0.45
89 0.44
90 0.4
91 0.44
92 0.41
93 0.35
94 0.28
95 0.25
96 0.21
97 0.21
98 0.22
99 0.18
100 0.2
101 0.18
102 0.17
103 0.17
104 0.17
105 0.16
106 0.14
107 0.12
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.12
114 0.14
115 0.15
116 0.15
117 0.16
118 0.18
119 0.23
120 0.25
121 0.27
122 0.27
123 0.29
124 0.3
125 0.29
126 0.27
127 0.21
128 0.2
129 0.17
130 0.15
131 0.13
132 0.11
133 0.09
134 0.09
135 0.12
136 0.17
137 0.22
138 0.26
139 0.27
140 0.28
141 0.3
142 0.38
143 0.44
144 0.42
145 0.4
146 0.37
147 0.4
148 0.42
149 0.47
150 0.4
151 0.36
152 0.34
153 0.34
154 0.33
155 0.3
156 0.31
157 0.25
158 0.24
159 0.24
160 0.21
161 0.2
162 0.21
163 0.23
164 0.25
165 0.32
166 0.35
167 0.36
168 0.41
169 0.45
170 0.45
171 0.44
172 0.41
173 0.42
174 0.46
175 0.45
176 0.41
177 0.4
178 0.38
179 0.4
180 0.43
181 0.38
182 0.34
183 0.35
184 0.4
185 0.43
186 0.45
187 0.47
188 0.5
189 0.53
190 0.57
191 0.55
192 0.53
193 0.53
194 0.57
195 0.58
196 0.56
197 0.55
198 0.52
199 0.52
200 0.55
201 0.54
202 0.56
203 0.52
204 0.5
205 0.48
206 0.47
207 0.47
208 0.46
209 0.43
210 0.41
211 0.43
212 0.46
213 0.48
214 0.46
215 0.43
216 0.4
217 0.38
218 0.33
219 0.3
220 0.25
221 0.25
222 0.24
223 0.24
224 0.22
225 0.2
226 0.19
227 0.18
228 0.18
229 0.13
230 0.14
231 0.13
232 0.18
233 0.18
234 0.17
235 0.15